KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01775Help
Entry
D7S_01775         CDS       T02046                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
aan00230  Purine metabolism
aan01100  Metabolic pathways
Module
aan_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    D7S_01775
Enzymes [BR:aan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     D7S_01775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_16 ABC_tran AAA_22 MMR_HSR1 AAA_23 cobW ATP-synt_ab AAA_35 AAA_29 Zeta_toxin AAA_33 Imm64 MobB
Motif
Other DBs
NCBI-ProteinID: AFI87508
Position
1662981..1663619
Genome map
AA seq 212 aa AA seqDB search
MLQGNLYIISAPSGAGKSSLIAALLKQNNNHKMMVSVSHTTRQSRPGEQEGVHYYFVSHG
EFETLIEQNAFLEYAKVFGGNYYGTSLFAIEENLAKGIDVFLDIDWQGAQQIRKKVPNVK
SIFILPPSLDELERRLIGRCQDSADVIADRMAKAMSEISHYNEYDYVIVNDNFEQALVDL
QAILRAERLTLTHQQQENQGLIEQLLEKSAAF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaggcaatttgtatatcatttcggcacccagcggtgcaggtaaatcttcatta
atcgccgcattgttaaaacaaaataataaccataaaatgatggtatccgtttcccacacc
accagacagtcgcgcccgggcgaacaagaaggcgtgcattattattttgtttctcacggg
gaatttgaaactttaatcgaacaaaatgcgtttttggaatacgcgaaagtctttggcggc
aattattacggcacgtctttattcgccattgaagaaaatttagccaaaggtattgatgtt
tttttggatattgattggcagggcgcacaacaaattcgcaaaaaagtgccgaatgttaaa
agtatttttattttaccgccgtcgttggatgaattggaaagacgcttaatcggacgctgt
caggacagtgcggatgtgattgccgacagaatggcgaaagcgatgagcgaaatttctcat
tacaatgaatatgattatgtgatcgtcaatgacaattttgaacaggcgcttgtagatttg
caggcaattctgcgtgccgaacggttgacattgacgcatcagcagcaagaaaatcaaggc
ttgattgaacaactactggaaaaatcagctgcattctag

DBGET integrated database retrieval system