KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01972Help
Entry
D7S_01972         CDS       T02046                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:aan01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aan01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aan00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:aan00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aan00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aan00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:aan00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1845242..1846207
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVYGIYDGYHGLYNNKIKQLTRYSVSD
IINRGGTFLGSARFPEFKDPDVRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHGFP
CVGIPGTIDNDVAGTDYTIGYQTALETAVEAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIRQIERSIIKGKRHAIIAITELICDVNELAREIEARV
KHETRATILGHIQRGGTPCAFDRILGSRMGVYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMRREFKADWLNMSKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagtattaacaagtggtggcgatgccccgggtatgaacgccgca
attcgcggtgtggtccgttcagcattagccgaagggttggaagtgtatggtatttacgac
gggtatcatggtttatataacaataaaatcaaacaattaacccgttatagtgtgtccgat
attatcaatcgcggcggtacattcttagggtctgcccgtttccctgaatttaaagatcct
gacgtgcgggcaaaatgcgcggagattttacgctcccacggcattgatgccttggtggtt
atcggcggtgacggttcctacatgggcgcaaaattattaacggaagaacatggtttccct
tgcgtggggattccgggcactatcgataacgacgttgccggcactgactacaccatcggt
taccaaaccgcccttgaaactgccgttgaagccatcgaccgcttacgcgatacctcaagt
tcccaccaacgcatctctatcgtcgaaatcatggggcgccattgtagcgatctcactatc
tccgcagggattgccggcggttgcgaatacatcgtggcatcagaaatcgaattcaatcgc
gaagaattaattcgccaaatcgaaagaagcattatcaaaggcaaacgtcacgcgattatc
gccattaccgagcttatttgcgacgtaaacgagttagcgcgcgaaattgaagcccgcgtg
aaacacgaaacccgcgccactattttgggtcatattcaacgtggcggcacaccttgtgcc
ttcgaccgtattttaggttcacgcatgggggtttatgccgttgatttgttattacaaggc
aaaggcggctactgtgtgggcattcaaaacgaacaattggttcaccacgatatcatcgac
gcgatcaacaatatgcgtcgtgaattcaaagccgattggttaaacatgtccaaacgtttg
gattaa

DBGET integrated database retrieval system