KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_02001Help
Entry
D7S_02001         CDS       T02046                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
aan00260  Glycine, serine and threonine metabolism
aan00750  Vitamin B6 metabolism
aan01100  Metabolic pathways
aan01110  Biosynthesis of secondary metabolites
aan01120  Microbial metabolism in diverse environments
aan01230  Biosynthesis of amino acids
Module
aan_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D7S_02001
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    D7S_02001
Enzymes [BR:aan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     D7S_02001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFI87721
Position
complement(1872672..1873946)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKDQGLFFPQNIPHLTNIDELLALPLIERSQKILGAL
IGEEIPPAQLEQVVRNAFTFPAPVVKVEDNIYALELFHGPTLAFKDFGGRFMAQALATVR
GDGKITILTATSGDTGAAVAHAFYGLDNIEVVILYPKGKISPLQEKLFCTFGGNIRTVAI
NADFDACQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAAAQLPKKQRENLV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIAATNANDTVPRYLHSGNWSPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWALTELHSAAISDGQTEETLRAMHKLGYLCEPHGAVAYEVLK
QDLQTGETGLFLCTAHPAKFKESVERILDLTLPLPEALDKHNKLPLLSDEMENDFAQLRA
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacatcaaacaccccgaagaacaagtcaatttcgctcaagcagtgcgc
caagggttaggcaaagatcaaggcttatttttcccgcaaaacataccgcacttaacgaat
atcgacgaactattggcattgccgttgattgaacgcagccaaaaaattctcggtgcgtta
atcggtgaagaaatcccgccggcacagcttgaacaagtggtgcgcaacgccttcaccttc
cccgcgccggtggtgaaagtggaagacaatatttatgcgctagaattattccacggaccg
acactcgcctttaaagatttcggcggacgcttcatggcgcaagctttagccaccgtacgc
ggtgatggcaaaatcaccattttaaccgccacttccggcgacaccggcgcggcggtagcg
catgccttctacggtttagacaatattgaagtggtgattttatatccgaaaggcaaaatc
agcccgttacaggaaaaactcttctgcacctttggcggcaatattcgcaccgtcgctatc
aacgccgatttcgacgcctgccaagcgttagtgaaacaagcctttgatgacgccgaattg
cgccaagccatcggtttaaactccgccaactccatcaatatcagccgtttattggcgcaa
gtgtgctattactttgaagcggcagcgcaattaccgaaaaaacagcgtgaaaatctcgta
gtctccgtgccaagcggcaacttcggcaacctcaccgccggcttaatcgccaaaaccctt
ggcttgccgatcaaacgctttatcgccgccaccaacgcaaacgacaccgtgccgcgctat
ttacacagcggcaattggtcaccgaacgccaccgttgccaccctttccaacgccatggac
gtttcccgcccgaataactggccgcgcgtggaagaattgttcaaacgtaacggctgggcg
ttaaccgaattacattcggcggcaatttccgatgggcaaacggaagaaacattacgcgca
atgcacaaactcggctatttatgcgagccacatggtgcggtggcgtatgaggtgcttaaa
caggatttacaaacgggtgaaaccggtttattcctttgcaccgcccacccggcgaaattc
aaggaatccgttgagcgcattctggatttaaccctgccattgccggaagccttggataaa
cataacaaactgccgttgttatccgatgaaatggaaaacgattttgcgcagttaagagct
tatttattgaaataa

DBGET integrated database retrieval system