KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_02159Help
Entry
D7S_02159         CDS       T02046                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:aan01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aan00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aan00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2041054..2042277
Genome map
AA seq 407 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGVLAQIL
QEEGATVVSKQLLGTLEDSVTAAAIATEKTAEPTPKDRRTEVPDEPHVTDAQGPAVRRLL
AEHGLQPSDVADVKGTGVGGRITREDVEAILAQRTAAAAQPQVAEDTLSTVAYAARSEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKQYGEKFEKQHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVTPVLRDCDNLSMADIEKS
IKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPVAL
NGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaaattcttgtccccgatttacccgaatccgtagccgatgctaccgtggcg
acttggcacaaaaaagcgggcgacgcagtgaaacgtgatgaagtgattgtggaaatcgag
accgacaaagtggtgcttgaagtgccggcacaggcggacggcgtgcttgcccagattttg
caggaagaaggggcaacggtggtcagtaaacagttgcttggtactctggaagattcagtg
acggcggcagccattgcaacggaaaaaacggcggagccgacaccgaaagatcgtcgcacg
gaagtgcctgatgaaccgcatgtcaccgatgcgcaaggcccggcggtgcgtcgtttatta
gccgagcacggtttacagccttccgatgttgccgatgtaaaaggcaccggcgtgggcggc
agaattacccgtgaagatgtggaagcgatccttgcccaacgcacggctgcagcggcacaa
ccgcaagtggcggaagataccctcagcaccgtggcgtatgccgcgcgtagcgaaaaacgc
gtaccaatgacccgtttacgtaagcgtattgcggaacgcctgttggaagccaaaaacacc
accgctatgttgactacgttcaatgaagtggatatgcagccgatcatgaacctgcgtaaa
caatacggcgaaaaatttgaaaaacaacacggcgtgcgtttaggtttcatgtctttttat
atcaaagccgtggtggaagccttaaaacgttatccggaagtgaacgcttccattgacggc
gacgatgtgatttatcacaactattttgacgtgagcattgcggtttcgactccacgcggt
ttagtgacgccggtattgcgcgattgcgacaatctttccatggcggacattgaaaaatcc
atcaaagccctggcggaaaaagggcgtgatggcaaattgacggtggaagatttaaccggc
ggtaacttcaccattaccaacggcggcgtgttcggttcattaatgtccactccgattatc
aacccgccgcaaagtgccattttaggtatgcacgccattaaagagcgtccggtggcgcta
aacggtcaagtagtgattcgcccgatgatgtatttggcattgagttacgaccaccgctta
attgacgggcgggaatccgtcggtttcttagtgacgataaaagagctactggaagacccg
acaagattattacttgaaatttaa

DBGET integrated database retrieval system