KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_02220Help
Entry
D7S_02220         CDS       T02046                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D7S_02220
Enzymes [BR:aan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     D7S_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2104605..2105261
Genome map
AA seq 218 aa AA seqDB search
MNDISPEAEKVRTALVQKGIETPMIVSDESKDERRTRIEQHMREVLRLIGLDLRDDSIEE
TPSRLAKMFVDEIFSGLDYANFPKITNIANRMKVSEMVLVNDVTLTSTCEHHFVTIDGKV
SVAYYPKKWVIGLSKINRIVTFFAQRPQVQERLTEQILLAFQTILETEDVAVYVKATHFC
VKCRGIKDANSYTVTSAFGGVFLEDRETRKEFLSLINK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatatttcacctgaagcagagaaagtccgtacggcgctggttcagaaaggaatt
gaaacaccgatgattgtgtcggacgaaagcaaagatgaacgtcgcacaagaatcgaacaa
catatgcgcgaagtgttgcgtttaatcggcttggatttacgtgacgacagtattgaagaa
accccgtcacgtcttgcaaaaatgttcgttgatgaaatttttagcggcttggattacgcc
aattttcctaagattacgaacattgccaatcgtatgaaagtgagtgaaatggtgttggtc
aatgatgtcacattaaccagcacctgcgaacatcatttcgttaccatcgacggaaaagtt
tccgtggcgtattacccgaagaaatgggttatcggcttatctaaaattaatcgcatagtg
acatttttcgctcaacgtccgcaagtgcaggagcgtttaacggaacaaattttgttggca
ttccaaaccattttggaaacggaagatgtggcagtttatgtgaaagccacccatttctgc
gtgaaatgccgtggtattaaagatgccaatagctataccgtgacctccgctttcggcggc
gtgttcttagaagatcgcgaaacgcgcaaagagtttttgagcttaattaataaataa

DBGET integrated database retrieval system