KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_02410Help
Entry
D7S_02410         CDS       T02046                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D7S_02410
Enzymes [BR:aan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     D7S_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2274125..2274943)
Genome map
AA seq 272 aa AA seqDB search
MINIQRQQQITPELSLYTYNEIPVLHLQHAIGTAKIALQGSHLFSWQPAHSKQDVLWLSE
IEPFETSTAIRGGIPICYPWFNNAGTPAHGFARISLWQLSDYAINADKVRLVFSLFSAHN
VILAKVEMLFGEHCDLRFTHYGEAGMEKVQLALHSYFNIGNIAHTDIANLPTECFNALTR
QQESVPSPRHIAENVDCVYTTQQLTEIRDHDNQRTIIVEHHNAGDVVLWNPWHKPTGNMT
ENGYQTMVCVETARINRYLDAGETVAVRLRVE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatattcaacgacaacaacaaatcacgcccgaactgagcttatatacctataac
gaaattcccgttttacatttacaacacgccataggcacggcaaaaatcgccttacaaggg
tcgcatttattcagctggcagccggcgcacagtaaacaggacgtgctgtggctaagtgaa
atcgaaccctttgaaaccagcacggcaattcgcggcggcatccccatttgctacccgtgg
tttaataacgccggcacacctgcacacggtttcgcccgtatcagcctgtggcagttgagc
gattacgcaattaatgccgataaagtgcggttggttttttcgttgttttccgcacacaat
gtaattttagcgaaagtggaaatgcttttcggcgaacattgtgacttgcgctttacccat
tacggtgaagcaggaatggaaaaagtgcagctggcgttacacagttatttcaacatcggc
aatatcgcccataccgacatcgccaacctgccgacggaatgcttcaacgccctcacccgt
caacaagaaagcgtgccgtcaccacgccatattgcggaaaacgtggattgtgtttacacc
acccaacaactgacggaaattcgcgaccatgacaatcaacgcacaatcattgtggaacac
cacaatgccggcgatgtggtgctgtggaacccatggcacaaacctaccggtaacatgaca
gaaaacggctatcaaactatggtctgcgtggaaacggcacgaatcaatcgctatcttgat
gcaggggaaacggtggcggtgagattgcgtgtggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system