KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0139Help
Entry
ANH9381_0139      CDS       T01651                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ANH9381_0139
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ANH9381_0139
Enzymes [BR:aao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ANH9381_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111389..112435
Genome map
AA seq 348 aa AA seqDB search
MSTLLIDLAGYELQQEEIELLEHPLVAGLILFTRNFHDRAQLQALIRSVRQKVKKPLLIT
VDQEGGRVQRFREGFTQIPAMQAFSALIKDPAQQQKMAQEAGWQMAAEMTALDIDLSFAP
VLDLGHQCKAIGDRSFGDDVKSAVDLAANFIRGMHQAGMAATGKHFPGHGHVIADSHLET
PYDERSKDEIFRQDIQPFQQLIEQHLLQAIMPAHVIYSQCDNQPASGSAYWLQDVLRHQL
HFNGAIFSDDLGMKGAGFMGDFVARSEQALNAGCDLLLLCNERDGVIQVLDQLKLTEKQP
HFLLRQQRLRRLFKRKSFTWSELESAPRWLENREKLTALQQQWLATKG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccacattactcattgacttagccggttacgaacttcaacaggaagaaatcgaactg
ctggaacacccgctggtggcgggtttaattctcttcacccgcaactttcacgatcgcgcg
caacttcaagcgcttatccgatccgtacgacaaaaagtgaaaaaaccgttgctgattacc
gtggatcaggaaggcggtcgggtacagcgttttcgtgaaggcttcactcaaattcccgcc
atgcaggcgttttccgcgctgattaaagatccggcgcaacaacagaaaatggcgcaggaa
gccggctggcaaatggcggcagaaatgaccgcacttgatattgatctgagcttcgcgccg
gtgctggatctcggtcaccaatgcaaagccatcggcgatcgcagtttcggtgacgacgtc
aaaagtgcggtggatttggcagccaattttattcgcggcatgcaccaggcaggcatggcg
gcaacgggcaaacactttcccgggcatgggcacgttatcgccgattcccatttggaaacg
ccttatgacgaacgaagcaaagacgagattttccggcaagacattcaaccgtttcaacaa
ctcattgaacaacaccttctgcaagccatcatgcccgctcatgtgatttactcgcaatgc
gataaccaaccggcgagcggttccgcctattggctgcaagatgttttacgccatcagctg
cattttaacggtgccattttctccgacgatctcggcatgaaaggcgccggatttatgggc
gattttgtagctcgcagtgaacaggcactgaatgcgggctgcgatttattattgctttgc
aacgaacgggacggcgtgattcaagtgttggaccagttaaaactcacggaaaaacaaccg
cactttttgctacgccaacagcgcttacgacgcctcttcaaacgtaaaagtttcacttgg
tcagagctggaatccgcgccacgttggttggaaaatcgcgaaaaactgaccgcacttcaa
cagcaatggctggcaaccaaaggttaa

DBGET integrated database retrieval system