KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0285Help
Entry
ANH9381_0285      CDS       T01651                                 

Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANH9381_0285
   01230 Biosynthesis of amino acids
    ANH9381_0285
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANH9381_0285
   00051 Fructose and mannose metabolism
    ANH9381_0285
   00562 Inositol phosphate metabolism
    ANH9381_0285
Enzymes [BR:aao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ANH9381_0285
Exosome [BR:aao04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ANH9381_0285
  Exosomal proteins of bladder cancer cells
   ANH9381_0285
  Exosomal proteins of melanoma cells
   ANH9381_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(246373..247140)
Genome map
AA seq 255 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTRELITGLKEELHGVTGCNVAIAPPVMYLAEAEAALVGSQI
VLGAQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFVAKKFGALKEA
GLVPVLCIGESEAENEAGKTEEVCARQIDAVINLLGVEAFNGAVIAYEPIWAIGTGKSAT
PAQAQAVHAFIRGHIAKKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLKA
PAFAVIVKAAAKAKN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcgttcacc
agagaattaattaccggtttgaaggaagaattgcatggtgtgaccggttgtaatgtggca
attgctccgccggtgatgtatttggcggaagcggaagctgcgctggttggcagtcaaatt
gttttaggtgcacaaaacgttgatgtgaacgtgaaaggtgcattcaccggcgatatttct
accgaaatgttaaaagatttcggcgcgaaatatatcattattggtcactccgaacgtcgt
acttatcataaagaaagcgatgaattcgtggcgaaaaaattcggtgcgttaaaagaagcg
ggcttggtgccggtgttatgtatcggtgaatccgaagcggaaaacgaagcaggaaaaacc
gaagaagtgtgcgcccgtcaaattgacgcggtgattaacctgttaggcgtggaagccttc
aatggcgcggtgattgcctacgaaccgatttgggcaatcggcaccgggaaatctgccact
ccggcgcaagcgcaagcggtacacgcgttcattcgcggtcatatcgcgaaaaaatcccaa
gcggttgccgatcaagttattattcaatacggcggttccgtaaacgatgccaacgcggcg
gaattgttcacccaaccggatattgacggtgcattggtgggcggcgcgtccttaaaagcc
ccggcatttgcggttatcgtaaaagcagcggcaaaagcgaaaaactaa

DBGET integrated database retrieval system