KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0299Help
Entry
ANH9381_0299      CDS       T01651                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ANH9381_0299
Enzymes [BR:aao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ANH9381_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
258326..259258
Genome map
AA seq 310 aa AA seqDB search
MCAKLVVLGSVNADHMIRVPRFARAGETLRGSGYRIAYGGKGANQAVAAARLKDPNTQVD
FIACLGNDDIGRTMKAAFAKDGINTATITQVEQEMTGVAMIQVADNGENSIVINAGANAC
LDEHLVSCYASHIQQADALLMQLETPLSAICKAAQIAKQNGTKVILNPAPAQALPEELLR
QLYMITPNETEAEILTDIKVEDKISAAQAAKRFHQLGVQIVLITLGAKGVYFSENGQGQI
IGGFRVKAKDTTAAGDTFNGALAVALLEGKTLTNAIRFAHAAAAISVTREGAQPSIPSRA
EALDFLEKQG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgctaaactcgttgtgctcggcagcgttaacgccgatcatatgattcgtgtcccg
cgttttgctcgcgccggtgaaacgttacgcggctccggttaccgcattgcttacggcggc
aaaggtgctaatcaggcggtagctgccgcacggttaaaagatccaaacacgcaggtggat
tttatcgcctgccttggtaacgatgacataggtcgtaccatgaaagccgcttttgcaaaa
gacggcattaacacggcgaccataactcaagttgagcaggaaatgacgggggtcgctatg
attcaagtggcggacaacggcgaaaacagcattgtaattaacgccggtgccaatgcctgt
ctggacgaacatctcgtttcctgttatgcctcgcatattcaacaagcggatgccttgtta
atgcagctggaaacccctctttcggcaatttgtaaagcggcgcaaatcgccaaacaaaac
ggtacaaaagtgattcttaatcctgcgccggcgcaagcattaccggaagaattgctccgg
cagttatatatgattacaccaaatgaaacggaagcggaaatcctgacggacattaaagtg
gaagataaaatctcggcagcacaggcggcaaaaagattccatcaactaggcgtgcaaatc
gtgcttattaccctgggtgccaaaggggtttatttcagtgaaaatggtcaggggcaaatt
atcggcggttttcgcgtaaaagcgaaagacaccacggcagcaggcgataccttcaatggt
gccttggcggttgcgttactggaaggaaaaacattgacgaatgccattcgcttcgcccac
gcagcggcggcaatcagcgtcacccgcgaaggtgcgcagccctcaattccgagccgtgcg
gaagccttggattttcttgaaaagcagggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system