KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0348Help
Entry
ANH9381_0348      CDS       T01651                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANH9381_0348
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ANH9381_0348
Enzymes [BR:aao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ANH9381_0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(join(312035..312229,312231..312407))
Genome map
AA seq 123 aa AA seqDB search
MQQNNKTIVVKFGTSTLTQGSPKLNLAYMMEIVRQLAQLHQAGFRLVIVTSGAIAAGRHN
YLNHPQLPPTVASKQLLAAEEQSQLIQTWEKLFAIYDIHIGQMLLTRADIEDRERFLNAR
VAG
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagaataataaaaccattgtggtgaaattcggcaccagcacgctcacgcagggc
tcgccgaaattgaatttagcctacatgatggaaattgttcgtcagttggcacaattacat
caggcaggttttcgcctggtgatcgtgacctcgggtgccattgccgccggtcgccataat
tatttaaatcacccgcaattgccgcccaccgtggcgtccaaacaattgctggcggcggag
gagcagagccagctgattcaaacctgggaaaaactgtttgccatttatgatattcacatc
gggcaaatgttgctgacccgcgccgatattgaagatcgcgaacgtttcctgaatgcacgc
gttgctggataa

DBGET integrated database retrieval system