KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0472Help
Entry
ANH9381_0472      CDS       T01651                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANH9381_0472
   01230 Biosynthesis of amino acids
    ANH9381_0472
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANH9381_0472
  Energy metabolism
   00680 Methane metabolism
    ANH9381_0472
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANH9381_0472
Enzymes [BR:aao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ANH9381_0472
Exosome [BR:aao04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ANH9381_0472
  Exosomal proteins of melanoma cells
   ANH9381_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
join(433697..434053,434056..434307)
Genome map
AA seq 202 aa AA seqDB search
MNLTERGVEEAKAAGKKLLDAGFEFDIAFTSVLTRAIKTCNIVLEESHQLWIPQVKNWRL
NERHYGELQGLDKKPPPKNMVTNKFTSGAVPTTHYHHYLIRKIQIPLTTTVATPIYRMMI
PDGENLKVTLARVLPFWDDQIALALLSGKRVLVVAHGNSLRALAKHIEGISDADIMDLEI
PTGQPLVYKLDDNLKVVEKFYL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttaaccgaacgtggtgtggaagaagccaaagcggcaggaaaaaagttattagac
gccggttttgaattcgacatcgccttcacttccgtcctgacccgtgccattaaaacctgt
aacatcgtcttggaagaatcccaccaattatggatcccgcaagtgaaaaactggcgctta
aacgaacgtcactacggcgaattacaaggcttagacaaaaagccaccgccgaaaaatatg
gtgacgaacaagttcacatctggcgccgttcctacgacacattaccaccattacttgatc
cgaaagatccaaattccgctcacaacgaccgtcgctacgcccatttaccggatgatgatt
ccggacggcgagaacctgaaagtcacgttagcgcgcgtgcttccgttctgggatgaccaa
atcgcccttgccctcttaagcggtaagcgcgttttagtggttgctcacggtaactcttta
cgtgcattggcaaaacacattgaaggcatttccgacgcagacattatggatttagaaatc
ccgaccggtcagccgttggtttacaaattagatgataatctgaaagtggttgagaaattc
tatttgtaa

DBGET integrated database retrieval system