KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0667Help
Entry
ANH9381_0667      CDS       T01651                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aao00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aao00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623018..624337
Genome map
AA seq 439 aa AA seqDB search
MTNYFNNIDKVRYEGPDSTNPFAYKYYDANQVILGKTMAEHLRLAVCYWHTFCWNGTDMF
GLGSLDRSWQKNAGTLEAAKQKADIAFEFFTKLGVPYYCFHDVDVAPEGNSIKDYIHNFN
TITDILERKQAETGVKLLWGTANCFSNPRYMSGASTNPNPEVFAWAATQVYHAMNATKRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQMVVEHKHNIGFNGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHTFQHEVATAFALDIFGSIDANRG
DPQSGWDTDQFPNSVEENTLVMYEILKNGGFTTGGFNFDAKIRRQSTDPYDLFYAHIGAI
DVLALSLKRAAQMLEEQRLQQLVDERYAGWRQSLGQQILLGNASLAQLAQAVEQQGLDPQ
PVSGKQEYLENLVNGYIYR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactacttcaacaacattgacaaagttcgctacgaaggtcctgactcaaccaat
cccttcgcgtataaatactacgacgccaatcaggtcattcttggcaaaaccatggcggag
catttgcgtttggcggtatgttattggcatacgttttgctggaacggtaccgatatgttc
ggcttgggttcgctggatcgaagctggcagaaaaatgccggcacgttagaggcggcaaaa
caaaaagcggatattgcttttgagtttttcaccaaattaggcgtgccttattattgtttc
cacgatgtggatgtggcgccggaaggcaattccattaaggattacattcataatttcaac
acaataacggacattcttgagcgtaaacaggcggaaaccggcgtgaagttgctgtggggc
acggcaaactgtttcagcaatccgcgttatatgtccggcgcctccaccaacccgaatccg
gaagtgttcgcctgggcggcaacgcaggtatatcacgccatgaatgctaccaagcgtttg
ggcggcgaaaactatgtgctctggggcggtcgcgaaggttatgaaaccctgctcaatacg
gacttaaaacgtgaacgcgagcaaatcggacgcttcatgcaaatggtggtggaacataaa
cataacatcggctttaacggcacattgcttatcgaaccgaaaccacaggaaccgaccaaa
catcaatacgattatgacgtggcgacggtttacggtttcttaaaacaattcggcttggaa
aatgaaattaaagtgaacattgaagccaaccacgccaccttggcggggcacaccttccag
catgaagtggcgacggcgttcgcgctggatattttcggctctatcgacgccaaccgcggc
gacccgcaatcaggctgggacaccgaccaattcccgaacagcgtggaagaaaacacgttg
gtgatgtacgaaatcctgaaaaacggcggttttaccaccggcggtttcaattttgatgcg
aaaatccgccgtcaaagtaccgatccttatgatttgttctatgcccatatcggcgctatc
gacgtattggcgttatccctcaaacgggcggcacaaatgctggaagaacaacggctgcaa
cagcttgtggacgaacgttatgccggttggcggcaatccctcggtcagcaaattttgctg
ggtaacgcttctttggcacagctcgcgcaggcggttgagcaacaaggcttggatccgcaa
ccggtgtccggtaaacaggagtatctggaaaacttggtgaacggttacatttaccgttaa

DBGET integrated database retrieval system