KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0680Help
Entry
ANH9381_0680      CDS       T01651                                 

Definition
CrcB protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ANH9381_0680
Enzymes [BR:aao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ANH9381_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634997..635920
Genome map
AA seq 307 aa AA seqDB search
MNNTELLQFAAQFPLQYLQGERQCRLAYRHFMHHPAARKLVIMVNGRAENLLKWTEIAQD
FYHQGYDVLLFDHRGQGYSQRLLKDGEKGHLDEFRFYPQDMAKIIENLTALYPYPQQYLI
AHSLGALISAYYLANFDHRIERAVFSAPFFGGPLKKPTRDELLLNLMMLWGQGERYVFGK
SAYKPVDTAQNELSHSVARMQWMNDVNRDNPSIRLGGPTFRWVHLCLAAIKRLPKILPRI
ETPVLVLESEQEKIVNNKTLKKLTALLPHGERRKIHGAKHEILFESDEIRTPVLQRIYAF
FNPNKHA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaccgaactgttgcaatttgccgcgcaatttccgttgcaatatcttcagggc
gaacgccaatgccgcttggcttatcggcattttatgcaccaccccgccgcccgtaaatta
gtgattatggtgaacggcagggcggaaaacctgctgaaatggacggaaattgcgcaggat
ttttatcatcaaggctacgatgtgttactgtttgatcatcgcgggcagggttattcgcaa
cgtttattgaaagatggcgagaaagggcatttagacgaatttcggttttacccgcaggac
atggcaaaaatcattgaaaatctgaccgcactttatccttatccgcagcaatacctgatc
gcccattccctcggcgcgctgatttccgcctattatttggcgaattttgatcatcgtatt
gaacgggcagtcttctccgcgccctttttcggggggccactcaaaaagccgacgcgcgac
gaattattgctgaatttgatgatgttatggggacaaggtgaacgttatgtgttcggcaaa
agcgcctacaagccagtggatacggcacagaacgagttaagtcacagtgtggcgcggatg
caatggatgaatgacgtgaatcgggacaacccgtcaattcggctgggcggaccgaccttc
cgttgggtacatttgtgtctcgccgccattaagcgtctgccgaaaattctgcctcgtatc
gaaacgccggtgttagtgttggagtccgaacaggaaaagatcgtgaacaataaaacgctg
aaaaaactgaccgcacttttgccccacggagagcggcgaaaaattcacggcgccaaacac
gaaattctgtttgaaagcgatgaaattcgtaccccggtactacaacgcatttatgcgttt
tttaatccaaacaagcacgcataa

DBGET integrated database retrieval system