KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0690Help
Entry
ANH9381_0690      CDS       T01651                                 

Definition
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Orthology
K00991  
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ANH9381_0690
Enzymes [BR:aao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     ANH9381_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642684..643379
Genome map
AA seq 231 aa AA seqDB search
MTSTRKIIAVVPAAGIGSRMQADKPKQYLHIHGQPILQHTLNVLLAYPHISRIVLAVAAD
DPYIDQLKLSQNPKIQLVEGGETRADSVLNGLNAVQDAGADVWVMVHDAARPCLTHGDLE
KLLEIQDDNGAILAIPATDTIKRALPSQQIAHTEDRSQLWLAQTPQFFRADLLRDALTRA
KQQQFAVTDEASAMELAGFRPHLVAGRSDNIKVTRPEDLALAEFYLTRKTI
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaacccgcaagattatcgccgtcgttcccgccgccggcatcggcagtcgaatg
caggcggacaaaccgaaacaatatcttcacattcacggacagccgattttacagcacacc
ttaaacgtactgttggcttatccgcacatcagccgaatcgtgctggcggtcgccgccgat
gatccttatattgaccaacttaagctcagccaaaacccgaaaattcagttggtggaaggc
ggtgaaacccgtgccgattccgtactcaacggtttaaatgccgtgcaggacgcgggcgcc
gacgtttgggtgatggtgcacgacgcggcgcgcccttgtttaactcacggcgatttagaa
aaattacttgaaattcaagatgataacggcgctattctcgccattccggcaacggacacc
attaagcgcgccctgccttcgcaacaaattgcccacacggaagatcgtagccaattatgg
ttggcacaaaccccgcagtttttccgtgcagatttattacgcgacgctttaacccgcgcc
aaacagcagcagtttgccgtcaccgacgaagcttccgccatggaactcgcgggatttcga
ccgcacttggtggcggggcgtagtgataacattaaagtcacccgcccggaagatttggcg
ctggcggaattttacttaacgaggaagacaatatga

DBGET integrated database retrieval system