KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0753Help
Entry
ANH9381_0753      CDS       T01651                                 

Definition
formamidopyrimidine-DNA glycosyllase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aao03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(701062..701919)
Genome map
AA seq 285 aa AA seqDB search
MYQYFPAPRILEKEMPELPEVETAVRGVSPYLKDYVIEKIVVRQPKLRWAVSPELAELHH
VKILDLTRRAKYLVIHTEQGYIIGHLGMSGTVRIVFHGSPIDKHDHLDIVVNNGKLLRYN
DPRRFGAWLWTEKLDEFHLFLKLGPEPLSEEFNAEYLFKKLHKKTTALKTVLMDNTVVVG
IGNIYANESLFLCGLHPLKLAANLTRKQCERLVDTIKSVLAKAIEQGGTTLKDFLQPDGR
PGYFAQELLVYGNKGKPCPKCGTKIESLVIGQRNSFYCPTCQKKG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttgtatcaatattttcccgccccacggattttggagaaagaaatgcccgaactgcctgaa
gtggaaaccgccgtacgcggtgtgagtccttatctgaaagattatgttattgaaaaaatc
gtagtccgccagccgaaactgcgctgggctgtatcgcctgaattggcagagttgcatcat
gtaaaaattttggatttaacccgtcgcgccaaatatctggttattcacaccgaacagggt
tacatcatcggacatttggggatgtcgggaacggtgcgtattgtgtttcatggcagcccg
attgataaacacgatcatcttgatattgtggtgaataacggcaaattactgcgttataac
gatccccgccgtttcggtgcctggctctggacggaaaaattggatgaattccatttattc
ttaaaactgggacctgagccgctatcagaggaattcaatgcagagtacttgtttaaaaaa
ttacacaaaaaaacaaccgcacttaaaaccgtattaatggataacaccgtggtggttggt
attggcaacatttatgccaatgaaagtctatttctgtgcgggttacatcctttgaagctc
gccgctaatctaactcgaaaacaatgcgaacgcttggtggataccattaaatcggtgctt
gccaaagccattgaacaaggcggcaccacgctaaaagattttctccagcccgacggcaga
ccggggtattttgcacaagaattgctggtttacggcaacaaaggcaaaccatgtccgaag
tgcggtacaaaaatcgagagtttagtcatcgggcaacggaatagtttttattgcccgacg
tgccagaagaagggataa

DBGET integrated database retrieval system