KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0753Help
Entry
ANH9381_0753      CDS       T01651                                 

Definition
formamidopyrimidine-DNA glycosyllase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:aao00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ANH9381_0753
Enzymes [BR:aao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     ANH9381_0753
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     ANH9381_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(701062..701919)
Genome map
AA seq 285 aa AA seqDB search
MYQYFPAPRILEKEMPELPEVETAVRGVSPYLKDYVIEKIVVRQPKLRWAVSPELAELHH
VKILDLTRRAKYLVIHTEQGYIIGHLGMSGTVRIVFHGSPIDKHDHLDIVVNNGKLLRYN
DPRRFGAWLWTEKLDEFHLFLKLGPEPLSEEFNAEYLFKKLHKKTTALKTVLMDNTVVVG
IGNIYANESLFLCGLHPLKLAANLTRKQCERLVDTIKSVLAKAIEQGGTTLKDFLQPDGR
PGYFAQELLVYGNKGKPCPKCGTKIESLVIGQRNSFYCPTCQKKG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttgtatcaatattttcccgccccacggattttggagaaagaaatgcccgaactgcctgaa
gtggaaaccgccgtacgcggtgtgagtccttatctgaaagattatgttattgaaaaaatc
gtagtccgccagccgaaactgcgctgggctgtatcgcctgaattggcagagttgcatcat
gtaaaaattttggatttaacccgtcgcgccaaatatctggttattcacaccgaacagggt
tacatcatcggacatttggggatgtcgggaacggtgcgtattgtgtttcatggcagcccg
attgataaacacgatcatcttgatattgtggtgaataacggcaaattactgcgttataac
gatccccgccgtttcggtgcctggctctggacggaaaaattggatgaattccatttattc
ttaaaactgggacctgagccgctatcagaggaattcaatgcagagtacttgtttaaaaaa
ttacacaaaaaaacaaccgcacttaaaaccgtattaatggataacaccgtggtggttggt
attggcaacatttatgccaatgaaagtctatttctgtgcgggttacatcctttgaagctc
gccgctaatctaactcgaaaacaatgcgaacgcttggtggataccattaaatcggtgctt
gccaaagccattgaacaaggcggcaccacgctaaaagattttctccagcccgacggcaga
ccggggtattttgcacaagaattgctggtttacggcaacaaaggcaaaccatgtccgaag
tgcggtacaaaaatcgagagtttagtcatcgggcaacggaatagtttttattgcccgacg
tgccagaagaagggataa

DBGET integrated database retrieval system