KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0868Help
Entry
ANH9381_0868      CDS       T01651                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aao00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(795237..796046)
Genome map
AA seq 269 aa AA seqDB search
MPILTTHLLQDVIEIAQQAGEHLRCFYQRSVTVRMKEDNTPVTEADLFVSQFLTEKLTAL
TPQIPILSEENCHIPLTERQTWRSYWLIDPLDGTQQFINRTGQFSVLISLVKDHQPVLGV
IYAPMLGSTYYAMQGFGAYKHHDGQHLKLTFHDIQADNALRIAVGSAAAAEKVRSILNKN
LAYEFHICGSSGLKSTLVADGVCDCYIRLGCTGEWDTAASEILLAEMGGIIFDLNYQPLT
YNKRESFVNPNFVMGITQDFPWDKIFHSN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcctcacgacccatttattgcaggatgtaatagagatcgcccaacaggcgggt
gagcatttacgttgcttttatcaacgttcggtgacagttcgaatgaaagaagacaacaca
ccggtgaccgaagcggatttattcgtcagccaatttttaacggaaaaactgaccgcactt
actccgcagattccgattctttctgaagaaaattgccatattccgctgaccgagcggcaa
acctggcgttcttactggttaatcgatcccctggacggcacgcaacaatttatcaatcgc
acaggtcaattctccgtgctcatcagtttggtgaaagatcatcaaccggtgttgggcgtg
atttatgcgccgatgttgggttccacctattacgccatgcaaggtttcggtgcgtataaa
caccatgacgggcagcatcttaaattaaccttccatgatattcaagcggacaatgccttg
cgtattgctgtgggttccgccgccgcagccgaaaaagtgcggtcgattttaaataagaat
ttggcttacgaatttcatatttgcggatccagcgggttaaaaagcacactggtggcagac
ggcgtatgcgattgctacattcgcttgggttgcaccggtgaatgggatactgccgcttcc
gagattttactggcggaaatgggtggcattatttttgacttgaattatcaaccgctgact
tataataaacgggaatctttcgtcaatccgaattttgtcatgggcatcacgcaggatttt
ccgtgggataaaatctttcactccaattaa

DBGET integrated database retrieval system