KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0983Help
Entry
ANH9381_0983      CDS       T01651                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ANH9381_0983
   00052 Galactose metabolism
    ANH9381_0983
   00500 Starch and sucrose metabolism
    ANH9381_0983
   00520 Amino sugar and nucleotide sugar metabolism
    ANH9381_0983
Enzymes [BR:aao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ANH9381_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(883947..884834)
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSIVPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVVLPDVLLAEFSANQKKENLALMLKRFKQTQASQIMVNPVKPEEVSSYGIADCGGV
EIPPGESAKIDSIVEKPSVDEAPSNLAVVGRYVFSATIWDLLEKTPVGVGDEIQLTDAID
MLIDKETVEAFHMTGISYDCGDKIGYMKAFVEYGLHHNKLASEFKAYLKDLVKTF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattattcctgttgcaggcttaggtacacgtatgttacctgctactaaagcc
attccgaaagaaatgttaactttagtggataaaccgctaatccaatatgtggtaaatgaa
tgtgtcgccgccggtattaaagaaatcgtcctggtgactcattcctcaaaaaatgccata
gaaaaccattttgatacttccttcgaattggaaacgatgctggaaaaacgcgtaaaacgc
caattattggaagaagtgcgttccatcgtgcccaaaaatgtcacaatcatgcacgttcgc
caaggtaatgcgaaagggttggggcatgccgtattgtgcggtcgtccgctggtgggtaac
gagccttttgccgtggtgttgccggatgtgttgctggccgagttttccgctaatcagaaa
aaagaaaatctggcgttaatgttaaaacgctttaaacaaacccaagccagccaaatcatg
gtgaacccggttaaacctgaagaagtcagcagttacggtatcgccgactgtggtggtgtg
gaaattcctccgggtgaaagtgccaaaattgatagtatcgtagagaaaccaagtgtggat
gaagcaccgtctaatttggctgttgtagggcgttatgtgttctcggcaaccatttgggat
ttattggaaaagaccccggtgggcgtgggcgatgaaatccagttaaccgatgccattgat
atgctgattgataaggaaaccgtcgaagccttccacatgacaggcatttcttacgactgc
ggcgataaaatcggttatatgaaagcctttgtggagtacgggctgcaccacaataaactt
gccagtgaatttaaagcttacctcaaagatttggtgaaaacattttaa

DBGET integrated database retrieval system