KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1122Help
Entry
ANH9381_1122      CDS       T01651                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aao01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:aao00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1029880..1031013
Genome map
AA seq 377 aa AA seqDB search
MKEKVVSLAQALIRRPSISPNDEGCQQLIAERLEKLGFQIEWLPFNDTLNLWAKHGSGDP
VIAFAGHTDVVPTGDESQWTYPPFDAKIVDDMLYGRGAADMKGSLAAMVVATEEYVKAHP
NHQGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSTQTLGDVVKNGRRG
SITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNDFFPPTSLQIANIHAG
TGSNNVIPGELYVQFNLRYCTEVTDGMIKQKVAEMLEKHGLKYRIEWNLSGKPFLTKPGK
LVSALVDSLQQIAGITPKLETGGGTSDGRFIALMGAEVVEFGPLNATIHKVNECVSVEDL
GKCGQIYHQMLVNLLEH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagttgtctctttggcgcaagcattaatccgtcgtccttccatcagcccg
aatgacgaaggctgccagcagctgattgcagaacggttagaaaaactcggttttcaaatt
gaatggctgccttttaacgacacgctaaatttatgggcgaaacatggcagtggcgatcct
gtcattgcctttgccgggcatacggatgtggtgccgacgggcgatgaaagccaatggact
tatccgcctttcgacgcaaaaattgtggacgatatgctttatggacgcggtgcggcggat
atgaaaggatcactggcagcaatggtagtggcaacggaagaatatgtaaaagcccatccg
aatcatcaaggcaccatcgcgttgttaattacttccgatgaagaagctgctgcgaaagac
ggcacggtgcgtgtggtggaaaccttaatggcgcgcggcgaaaagatcacttattgcatg
gtgggcgagccttccagtacgcaaaccttgggcgatgtagtgaaaaacggtcgccgtggt
tccatcacaggcaatctgtatattcagggcattcaagggcacgttgcctatccccatctg
gcggagaatcctattcacaaagccgcgccgttcttgcaggagctcaccacataccaatgg
gacaacggcaatgacttttttcctccaaccagtctgcaaatcgctaatattcatgccggc
accggcagcaataatgtgattccgggcgagctttatgtgcaatttaatttgcgttattgc
acggaagtgacggacgggatgattaagcagaaagtcgccgagatgctggaaaaacacggg
ctgaagtatcgtattgaatggaatctttccggcaagccgtttttaaccaaaccgggaaaa
ctggtgagtgcgttggtggacagcctgcaacaaatcgcaggcattacgccgaaattggaa
accggtggtggcacctcagacggacgttttattgccctcatgggcgcggaagtggtggaa
ttcggaccgcttaacgccaccattcataaagtaaacgagtgcgtgagcgtggaagatctt
ggcaaatgcggtcagatttaccatcaaatgttagtgaatttattggaacattag

DBGET integrated database retrieval system