KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1146Help
Entry
ANH9381_1146      CDS       T01651                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ANH9381_1146
DNA repair and recombination proteins [BR:aao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ANH9381_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051282..1051884
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLENLIESLRVLPGVGPKSAQRMAYHLLQRNRSGGMRLAQGLTEAMSKIGHCEHC
RTFTEEDVCNICSNPRRQNSGLLCVVETPADILAIEQTGQFSGRYFVLMGHLSPLDGIGP
CEIGLDLLQKRLQTESFNEVILATNPTVEGDATANYIAELCLQQNVKVSRIAHGIPVGGE
LEMVDGTTLTHSFLGRREIG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccccttgttagaaaatctgatcgaaagtttacgcgtattgccgggcgtc
ggtccgaaatccgcgcaacgtatggcgtatcatttattgcaacgcaatcgcagcggcgga
atgcgcttggcgcaagggctgacggaagcgatgtcgaaaatcgggcattgcgaacattgc
cgcacttttacggaagaagacgtgtgcaacatttgcagtaatccacgccgccaaaattcg
ggcttgctttgcgtggtggaaacgccggcggatattcttgctatcgagcaaacagggcag
ttttccgggcgttatttcgtgctgatggggcatttgtcgccgctggacggtatcggcccg
tgcgaaattggcttggatttgttgcaaaaacgcctgcaaacggaatctttcaatgaagtg
attttagccactaacccgacggtagaaggcgacgccacagcaaactacattgcggagctt
tgcctgcaacaaaacgtcaaagtcagccgtattgcccacggcattccggtggggggcgaa
ttggaaatggtggacggcaccacgctgacccattccttcttaggtcgccgtgaaatcggc
taa

DBGET integrated database retrieval system