KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1146Help
Entry
ANH9381_1146      CDS       T01651                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aao03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051282..1051884
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLENLIESLRVLPGVGPKSAQRMAYHLLQRNRSGGMRLAQGLTEAMSKIGHCEHC
RTFTEEDVCNICSNPRRQNSGLLCVVETPADILAIEQTGQFSGRYFVLMGHLSPLDGIGP
CEIGLDLLQKRLQTESFNEVILATNPTVEGDATANYIAELCLQQNVKVSRIAHGIPVGGE
LEMVDGTTLTHSFLGRREIG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccccttgttagaaaatctgatcgaaagtttacgcgtattgccgggcgtc
ggtccgaaatccgcgcaacgtatggcgtatcatttattgcaacgcaatcgcagcggcgga
atgcgcttggcgcaagggctgacggaagcgatgtcgaaaatcgggcattgcgaacattgc
cgcacttttacggaagaagacgtgtgcaacatttgcagtaatccacgccgccaaaattcg
ggcttgctttgcgtggtggaaacgccggcggatattcttgctatcgagcaaacagggcag
ttttccgggcgttatttcgtgctgatggggcatttgtcgccgctggacggtatcggcccg
tgcgaaattggcttggatttgttgcaaaaacgcctgcaaacggaatctttcaatgaagtg
attttagccactaacccgacggtagaaggcgacgccacagcaaactacattgcggagctt
tgcctgcaacaaaacgtcaaagtcagccgtattgcccacggcattccggtggggggcgaa
ttggaaatggtggacggcaccacgctgacccattccttcttaggtcgccgtgaaatcggc
taa

DBGET integrated database retrieval system