KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1176Help
Entry
ANH9381_1176      CDS       T01651                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANH9381_1176
   00052 Galactose metabolism
    ANH9381_1176
Enzymes [BR:aao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ANH9381_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081513..1082544
Genome map
AA seq 343 aa AA seqDB search
MLEQRAQSTAPDGLPFNLFILQNAQGMRVQFTDWGATWISCCLPVNGELREVLLGCKLED
YPVQQAYLGVSVGRYANRIANAQFPLNGKVVRLTANQGKHQLHGGNGFDKRRWTLEKCGE
NFVCFSLYSADGDQGFPGNVKATVTYTLTEDNAVKIEYAAQSDQDTALNLTNHAYFNLEN
AMQGADVRNHSLRLNADFYLPVDSEGIPNSPLKHVVGTGFDFRIAKPIKQDFLQGEQLAA
KGYDHSFIVNKAWQKPCVLLTSPNGDLSLEVLTSQAALQVYTGNFLAGTPTREGAQYADY
HGIALETQCLPDTPNHPEWQNYGGIVKAGEEYYQWTEYRFKGN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacaacgtgcacaaagcactgcaccggacggcttgccgtttaacctgtttatc
ttgcaaaacgcacaaggtatgcgcgtgcaatttaccgactggggtgcgacttggatctct
tgttgtctgccggtcaacggcgaattgcgtgaagtgctgttgggctgcaaattggaagat
tatcccgttcaacaagcctacttaggcgtgagcgtaggacgctatgccaatcgtatcgcc
aacgcgcaatttccgttgaatggcaaagttgtgcgcttaaccgccaaccaaggcaaacac
caactgcacggcggaaacggtttcgataaacgccgttggacgttggaaaagtgcggtgaa
aattttgtgtgtttttcattgtattccgccgacggcgatcaaggtttccccggcaatgtg
aaggcgacggtaacttacaccttgacggaagataatgcggttaaaatcgaatatgccgcc
caaagcgatcaggataccgcactgaatttaaccaatcacgcctatttcaatttagaaaat
gcgatgcagggcgcagatgtgcgcaaccatagcttgcgcctcaacgccgatttttattta
ccggtggatagcgaaggcattcctaactcgccgctcaaacatgttgtcggcaccggcttt
gatttccgcatagccaagccaattaaacaggattttttgcaaggagaacagcttgctgcc
aaaggctacgaccattcttttattgtgaataaagcctggcaaaaaccttgtgttctgctc
acctctccaaacggcgatttaagcctggaagtgctgacttcacaagccgccttacaggtt
tacaccggcaacttcctcgccggcacgccgacccgtgagggtgctcaatatgccgactac
cacggcatcgccctggaaacccaatgccttcccgataccccaaatcaccccgaatggcaa
aattacggcggcattgtaaaagcaggcgaagaatattaccaatggacggaatatcgattt
aagggaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system