KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1191Help
Entry
ANH9381_1191      CDS       T01651                                 

Definition
Chb protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aao00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aao00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1096918..1097940
Genome map
AA seq 340 aa AA seqDB search
MLDIARHFYSPEVIKSFIDTISLSGGNFLHLHFSDHENYAIESHLLNQRAENAVQGKDGI
YINPYTGKPFLSYRQLDDIKAYAKAKGIELIPELDSPNHMTAIFKLVQKDRGVKYLQGLK
SRQVDDEIDITNADSIAFMQSLMNEVIDIFGDTSQHFHIGGDEFGYSVESNHEFITYANK
LSYFLEKKGLKTQMWNDGLIKSTFEQINPNIEITYWSYDGDTQDKNEAAERRDMRVSLPE
LLAKGFTVLNYNSYYLYIVPKASPTFSQDAAFAAKDVIKNWDLGVWDGRNTKNRVQNTHE
IAGAALSIWGEDAKALKDETIQKNTKSLLEAVIHKTNGDE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctggacatcgcccgacatttttattcacccgaggtgattaaatcctttattgatacc
atcagcctttccggcggtaattttctgcacctgcatttttccgaccatgaaaactatgcg
atagaaagccatttacttaatcaacgtgcggaaaatgccgtgcagggcaaagacggtatt
tatattaatccttataccggaaagccattcttgagttatcggcaacttgacgatatcaaa
gcctatgctaaggcaaaaggcattgagttgattcccgagcttgacagtccgaatcacatg
acggcgatctttaaactggtgcaaaaagacagaggggtcaagtatcttcaaggattaaaa
tcacgccaggtagatgatgaaattgatattactaatgctgacagtattgcctttatgcaa
tctttaatgaatgaggttattgatatttttggcgacacgagtcagcattttcatattggt
ggcgatgaatttggttattctgtggaaagtaatcatgagtttattacgtatgccaataaa
ctatcctactttttagagaaaaaggggttgaaaacccaaatgtggaatgacggattaatt
aaaagtacttttgagcaaatcaacccgaatattgaaattacttattggagctatgatggc
gatacgcaggacaaaaatgaagctgccgagcgtcgtgatatgcgggtcagtttgccggag
ttgctggcgaaaggctttactgtcctgaactataattcctattatctttacattgttccg
aaagcttcaccaaccttctcgcaagatgccgcctttgccgccaaagatgttataaaaaat
tgggatcttggtgtttgggatggacgaaacaccaaaaaccgcgtacaaaatactcatgaa
atagccggcgcagcattatcgatctggggagaagatgcaaaagcgctgaaagacgaaaca
attcagaaaaacacgaaaagtttattggaagcggtgattcataagacgaatggggatgag
tga

DBGET integrated database retrieval system