KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1191Help
Entry
ANH9381_1191      CDS       T01651                                 

Definition
Chb protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ANH9381_1191
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ANH9381_1191
Enzymes [BR:aao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ANH9381_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1096918..1097940
Genome map
AA seq 340 aa AA seqDB search
MLDIARHFYSPEVIKSFIDTISLSGGNFLHLHFSDHENYAIESHLLNQRAENAVQGKDGI
YINPYTGKPFLSYRQLDDIKAYAKAKGIELIPELDSPNHMTAIFKLVQKDRGVKYLQGLK
SRQVDDEIDITNADSIAFMQSLMNEVIDIFGDTSQHFHIGGDEFGYSVESNHEFITYANK
LSYFLEKKGLKTQMWNDGLIKSTFEQINPNIEITYWSYDGDTQDKNEAAERRDMRVSLPE
LLAKGFTVLNYNSYYLYIVPKASPTFSQDAAFAAKDVIKNWDLGVWDGRNTKNRVQNTHE
IAGAALSIWGEDAKALKDETIQKNTKSLLEAVIHKTNGDE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctggacatcgcccgacatttttattcacccgaggtgattaaatcctttattgatacc
atcagcctttccggcggtaattttctgcacctgcatttttccgaccatgaaaactatgcg
atagaaagccatttacttaatcaacgtgcggaaaatgccgtgcagggcaaagacggtatt
tatattaatccttataccggaaagccattcttgagttatcggcaacttgacgatatcaaa
gcctatgctaaggcaaaaggcattgagttgattcccgagcttgacagtccgaatcacatg
acggcgatctttaaactggtgcaaaaagacagaggggtcaagtatcttcaaggattaaaa
tcacgccaggtagatgatgaaattgatattactaatgctgacagtattgcctttatgcaa
tctttaatgaatgaggttattgatatttttggcgacacgagtcagcattttcatattggt
ggcgatgaatttggttattctgtggaaagtaatcatgagtttattacgtatgccaataaa
ctatcctactttttagagaaaaaggggttgaaaacccaaatgtggaatgacggattaatt
aaaagtacttttgagcaaatcaacccgaatattgaaattacttattggagctatgatggc
gatacgcaggacaaaaatgaagctgccgagcgtcgtgatatgcgggtcagtttgccggag
ttgctggcgaaaggctttactgtcctgaactataattcctattatctttacattgttccg
aaagcttcaccaaccttctcgcaagatgccgcctttgccgccaaagatgttataaaaaat
tgggatcttggtgtttgggatggacgaaacaccaaaaaccgcgtacaaaatactcatgaa
atagccggcgcagcattatcgatctggggagaagatgcaaaagcgctgaaagacgaaaca
attcagaaaaacacgaaaagtttattggaagcggtgattcataagacgaatggggatgag
tga

DBGET integrated database retrieval system