KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1347Help
Entry
ANH9381_1347      CDS       T01651                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aao00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248461..1249117
Genome map
AA seq 218 aa AA seqDB search
MNDISPEAEKVRTALVQKGIETPMIVSDESKDERRTRIEQHMREVLRLIGLDLRDDSIEE
TPSRLAKMFVDEIFSGLDYVNFPKITNIANRMKVSEMVLVNDVTLTSTCEHHFVTIDGKV
SVAYYPKKWVIGLSKINRIVTFFAQRPQVQERLTEQILLAFQTILETEDVAVYVKATHFC
VKCRGIKDANSYTVTSAFGGVFLEDRETRKEFLSLINK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatatttcacctgaagcagagaaagtccgtacggcgctggttcagaaaggaatt
gaaacaccgatgattgtgtcggacgagagcaaagatgaacgtcgcacaagaatcgaacaa
catatgcgcgaagtgttgcgtttaatcggcttggatttacgtgacgacagtattgaagaa
accccgtcacgtcttgcaaaaatgttcgttgatgaaatttttagcggcttggattacgtc
aattttcctaagattacgaacattgctaatcgtatgaaagtgagtgaaatggtgttggtc
aatgatgtcacattaaccagcacctgcgaacatcattttgttaccatagacggaaaagtt
tccgtggcgtattacccgaagaaatgggttatcggcttatctaaaattaatcgcatagtg
acatttttcgctcaacgtccgcaagtgcaggagcgtttaacggaacaaattttgttggca
ttccaaaccattttggaaacggaagatgtggcggtttatgtaaaagcaacccatttctgc
gtgaaatgccgtggcattaaagatgccaacagctacaccgtcacctccgctttcggcggc
gtgttcttagaagatcgcgaaacacgcaaagagtttttgagtttaattaataaataa

DBGET integrated database retrieval system