KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1347Help
Entry
ANH9381_1347      CDS       T01651                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ANH9381_1347
Enzymes [BR:aao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ANH9381_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248461..1249117
Genome map
AA seq 218 aa AA seqDB search
MNDISPEAEKVRTALVQKGIETPMIVSDESKDERRTRIEQHMREVLRLIGLDLRDDSIEE
TPSRLAKMFVDEIFSGLDYVNFPKITNIANRMKVSEMVLVNDVTLTSTCEHHFVTIDGKV
SVAYYPKKWVIGLSKINRIVTFFAQRPQVQERLTEQILLAFQTILETEDVAVYVKATHFC
VKCRGIKDANSYTVTSAFGGVFLEDRETRKEFLSLINK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatatttcacctgaagcagagaaagtccgtacggcgctggttcagaaaggaatt
gaaacaccgatgattgtgtcggacgagagcaaagatgaacgtcgcacaagaatcgaacaa
catatgcgcgaagtgttgcgtttaatcggcttggatttacgtgacgacagtattgaagaa
accccgtcacgtcttgcaaaaatgttcgttgatgaaatttttagcggcttggattacgtc
aattttcctaagattacgaacattgctaatcgtatgaaagtgagtgaaatggtgttggtc
aatgatgtcacattaaccagcacctgcgaacatcattttgttaccatagacggaaaagtt
tccgtggcgtattacccgaagaaatgggttatcggcttatctaaaattaatcgcatagtg
acatttttcgctcaacgtccgcaagtgcaggagcgtttaacggaacaaattttgttggca
ttccaaaccattttggaaacggaagatgtggcggtttatgtaaaagcaacccatttctgc
gtgaaatgccgtggcattaaagatgccaacagctacaccgtcacctccgctttcggcggc
gtgttcttagaagatcgcgaaacacgcaaagagtttttgagtttaattaataaataa

DBGET integrated database retrieval system