KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1565Help
Entry
ANH9381_1565      CDS       T01651                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ANH9381_1565
Enzymes [BR:aao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ANH9381_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1460754..1461254
Genome map
AA seq 166 aa AA seqDB search
MNKVYVALGSNLADPQAQLVAALRAMNQLPGSRLISVSSFYQSKPLGPQDQPDYVNAVAC
LETALSPLALLDELQRIEQEQGRVRLRRWGERTLDLDILLYADQTIQSERLTVPHYDMHN
REFVIIPLAEIAPSFSLPNGQSIRELMQNFTHHKMVIVKEKGEVVF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggtgtatgtcgctttaggcagtaatttagcggatccgcaagcacaactggtc
gccgcattacgggcgatgaatcaattgcctggcagccgtctgattagcgtcagttctttt
tatcaaagcaaacctctcggtccgcaagatcagcctgattatgtcaacgccgtcgcttgc
ctggaaacggcgctttctcccctcgcattgcttgatgaattacaacgtattgaacaggaa
caagggcgtgtccgtcttcgtcgttggggtgagcgcacattagatctggatattttgctt
tacgccgatcaaaccattcagtcggaacgtctgactgttccccattatgatatgcacaat
cgtgaatttgtaattatcccgttggcggaaatcgcaccttcgttttccttgccgaacggg
caatccatcagggagttaatgcaaaattttacccatcataaaatggtgattgtgaaagag
aagggcgaggttgtgttttaa

DBGET integrated database retrieval system