KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1578Help
Entry
ANH9381_1578      CDS       T01651                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANH9381_1578
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANH9381_1578
   00020 Citrate cycle (TCA cycle)
    ANH9381_1578
   00620 Pyruvate metabolism
    ANH9381_1578
Enzymes [BR:aao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ANH9381_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1478568..1480238
Genome map
AA seq 556 aa AA seqDB search
MLGMKSAVGFKNIFKGKKEMAKQIQIPDIGSDEVTVTEVMVNVGDSITADQSIINVEGDK
ASMEVPAPEAGVVKEILVKVGDKVTTGTPMLVLDSADAAPAQAPQAEAPAPQAAPAAAQV
VDVNVPDIGGDEVNVTDVMVNVGDRVEVDQSIINVEGDKASMEVPAPVAGIVKEIIIKAG
DKVSTGTLIMRFETAGSAPAAAPVASSPAAAPAPTEQAVPQAVPAPTAQASAPAAASSSQ
ADVESAKSYAHATPVIRRLAREFGVNLDKVKGTGRKGRILKEDIQAYVKAAVKALESGAA
ATGAANGAGLGLLPWPKVDFRKFGEIEEVELSRINKISGANLHRNWVMIPHVTHFDKADI
TELEAFRKEQNALSEKQKLGVKITPVVFIMKAVAKALEAFPRFNSSITEDAQRLILKKYI
NVGVAVDTPNGLVVPVFKDVNKKGIIELSRELMEVSKKARDGKLTAADMQGGCFTISSLG
GIGTTHFAPIVNAPEVAILGVSKSAMEPVWNSKEFVPHLILPISLSFDHRVIDGADGARF
ISYIGSVLADLRRLIM
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcatgaaaagtgcggtcggttttaaaaacatttttaaaggtaaaaaagaaatg
gctaaacaaattcaaatcccggatatcggtagtgatgaagttaccgtaaccgaagtgatg
gtaaacgttggagatagcatcactgcggatcaatccattattaatgttgaaggtgacaag
gcttctatggaagtgccggcaccggaagcgggcgtggtaaaagaaattttagtaaaagtg
ggcgacaaagtgactaccggcacgccgatgttggtgttagatagtgccgatgccgcaccg
gctcaagcgcctcaagctgaggcacctgcaccgcaagccgcgcctgccgccgcacaagtg
gtggatgttaatgtacctgacatcggcggtgacgaagtgaacgtgaccgatgtgatggtg
aacgtgggtgatcgtgttgaagtggatcaatccattattaatgttgaaggtgataaggct
tctatggaagtaccggcaccggtggcgggtatcgttaaagaaattattatcaaagccggc
gataaagtgtccacaggtacgttaatcatgcgttttgaaacggcgggcagtgcgcctgca
gctgctccggtagcttcttcgcctgctgcagcgccggcaccgactgagcaagcagtacca
caagctgtacctgcaccgacagcacaggcttccgcgccggcagccgcatcttcttcccaa
gcggatgttgaaagtgcgaaaagctatgcgcacgccacaccggtgattcgtcgtttagcg
cgcgaattcggtgtgaacctggataaagtaaaaggcacaggtcgtaagggtcgtatttta
aaagaagatattcaagcctatgtgaaagccgccgtgaaagctttggaaagcggtgctgcg
gcaacaggcgcggcgaatggtgccggtttaggcttgttaccgtggccgaaagtggatttc
agaaaattcggcgaaatcgaagaagtggaattaagtcgtatcaacaagatttcgggtgcg
aatttacatcgtaactgggtcatgattccgcatgttacccatttcgataaagcggacatc
accgagttggaagcattccgtaaagagcaaaacgccttgtctgaaaaacaaaaactgggc
gtgaaaatcacccctgtggtcttcattatgaaagccgttgccaaagcgttggaagccttc
ccgcgtttcaacagctccattaccgaagatgcccaacgtttgatcctgaaaaaatacatc
aatgtgggcgtggcggtagatacgccgaacggtttagttgtaccggtctttaaagatgtc
aacaaaaaaggcattatcgagctttcccgtgaattgatggaagtgtccaaaaaagcccgt
gacggtaaattaaccgcagcggatatgcaaggcggttgtttcaccatttccagccttggc
ggcattggtacaacacattttgcaccaatcgtgaatgcacctgaagtggcgattttgggt
gtctccaaatccgctatggaaccggtttggaacagtaaagaatttgtgccgcacttgatt
ctgccgatttccttatccttcgaccaccgtgttattgacggtgcggacggtgcacgcttc
atcagctacatcggttccgtattagccgacttacgtcgtttaattatgtaa

DBGET integrated database retrieval system