KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1720Help
Entry
ANH9381_1720      CDS       T01651                                 

Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
aao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aao01100  Metabolic pathways
aao01110  Biosynthesis of secondary metabolites
aao01130  Biosynthesis of antibiotics
aao01230  Biosynthesis of amino acids
Module
aao_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANH9381_1720
Enzymes [BR:aao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ANH9381_1720
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ANH9381_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C HHH_4
Motif
Other DBs
NCBI-ProteinID: AEW77655
Position
1622414..1623802
Genome map
AA seq 462 aa AA seqDB search
MLQKIVLDKAQWVKAKAAEFPLSAFEKNIEKSDRTFYGALAQGSHEKPAYILECKKASPS
KGLIRSEFKPTEIAQVYKNYASVISVLTDEKYFQGDFAYIQQVRDVVTQPVLCKDFIINE
YQVYLARFHQADAILLMLSVVNDETYRILADLAHSLGMGVLTETSNEEEFERALALGAKI
IGVNNRNLHDLTVDLNRVVELTAKYADKIPEDVRIISESGIYNHQQVRELQHVAHGFLIG
SSLMGSADLNNTVREVIFGENKVCGLTRAQDVKTAYDNGALYGGLIFAEQSKRCVSLRQA
QELVTAAPLRFVGVFQNQNIDFIVKIAQQLQLHAVQLHGDETPAFITALRAQLPQHIRIW
KAISVDVKHKSAVNFDDVSEVDRFVFDSKSGTQQGGTGATFDWSLIPQELKYKIILAGGI
SPSNIEDALAQHCVGVDLNSGVESAPGVKNAEKVRSVFAKIL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgctacaaaaaatcgttctcgacaaagctcaatgggtgaaagccaaagcggcggaattt
ccgttgagtgcctttgaaaaaaacatcgaaaaatccgaccgcactttttatggtgcgttg
gcgcaaggttcgcatgaaaagccggcatatattctggaatgtaaaaaagcctcgccttcc
aaaggattgattcgcagtgaatttaaaccgacagagattgcacaggtgtataaaaattac
gcgagcgtgatttccgtgctaaccgatgaaaaatatttccaaggggattttgcctatatt
cagcaagttcgcgacgttgtcacgcaaccggtgttgtgcaaagactttataatcaacgaa
tatcaggtttatttggcacgttttcatcaagccgacgccattttactgatgctttccgtg
gtgaacgacgaaacctatcgcattttggcggatttggcccattccctcggcatgggcgtg
ctgaccgaaaccagcaacgaggaagaatttgaacgcgccttggcgttaggcgcaaaaatt
atcggcgtgaacaatcgtaacctgcatgatttaacggtagatttaaatcgcgtggtggaa
ctcaccgccaaatatgcggataaaatccctgaggatgtgcgaatcatcagcgaatcgggc
atctataatcatcaacaagtgcgtgaattacaacacgttgcccatggctttttaatcggc
agcagcttaatgggcagcgcggatttaaataacaccgtgcgcgaagtgattttcggtgaa
aacaaagtgtgtggcttaacccgtgcgcaggatgtgaaaactgcttacgacaacggcgct
ttatacggtgggctaattttcgccgaacagtctaaacgctgcgtcagtttacgtcaggcg
caggaattggtgaccgccgccccactgcgttttgtgggcgtgttccaaaatcagaacatt
gattttattgtgaaaatcgcccaacagctacaactccacgccgttcagctacacggtgac
gaaacgccggcatttatcaccgcacttcgtgctcaattgccgcaacatattcgtatttgg
aaagccatttctgtagatgtgaagcataaaagtgcggttaattttgacgacgtttctgag
gtggatcgttttgttttcgacagcaaatcaggtacacaacaaggcggcacgggggcgact
tttgattggtcactgattccgcaggaattgaaatataaaattattctggcgggcggcatt
agcccgagtaatattgaagacgcattggcacaacattgtgtgggtgttgatctcaattcc
ggcgtagaaagcgccccgggcgtgaaaaatgccgaaaaagtgcggtcggtttttgcgaag
attttgtaa

DBGET integrated database retrieval system