KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1732Help
Entry
ANH9381_1732      CDS       T01651                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANH9381_1732
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANH9381_1732
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANH9381_1732
Enzymes [BR:aao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ANH9381_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1633238..1634431
Genome map
AA seq 397 aa AA seqDB search
MAETILNPYFGEFGGMYVPEILVPVLQQLEKAFVEAKADPAFQREFQDLLKNYAGRPTAL
TLCRNLTKGTNAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGTEVVPVQKGSCSLKDACCEAMRDWSA
NYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQMLEKEGRLPDAVIAAVGGGSNAIG
MFTDFIDEKEVRLIGVEPAGKGIETGKHGAPLGHAKVGIYFGMKSPLMQTEDGQVEESYS
ISAGLDFPSVGPQHAYLQSIGRAEYPSITDNEALDAFQALAKHEGIIPALESSHALAQAL
KMIRQEPNKAQILVVNLSGRGDKDIFTVDKILNEKGM
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgattttaaacccgtatttcggggaattcggcggaatgtatgtgccggaa
attctagtgccggtgttgcaacagttggaaaaagcgtttgtagaagccaaggcggatcct
gcatttcagcgcgaatttcaggatttattgaaaaattatgccggcagacccaccgcactt
accctttgtcgcaatcttaccaaaggcaccaacgccaaaatctatttaaaacgggaagat
ttattacacggcggcgcacataaaaccaaccaggtattaggtcagattttgcttgccaaa
cgcatgggcaaaacccgcattattgccgaaaccggcgcgggacagcacggtgtcgccact
gctctcgcctgcgccatgttggatatgccgtgccgtgtttatatgggcgcgaaagatgtg
gaacgccaatcgccgaatgtgtttcgtatgcgtttaatgggcacggaagtggtaccggtg
caaaaaggttcctgttctttgaaagacgcttgctgcgaagccatgcgtgactggtcggca
aattatgaaaatacgcactatttgctcggcacagcggcaggtccgcacccttttccgact
atcgtgcgtgaattccagaaaatgatcggggaagaaaccaaacgccaaatgctggaaaaa
gaaggtcgtttaccggacgcggtaattgcggcagtcggcggtggctcaaatgcgatcgga
atgtttaccgattttattgacgaaaaagaggtgcgtttaatcggcgtggaacctgccggc
aaaggcattgaaacgggcaaacacggcgcgccgttaggtcatgccaaagtgggaatttat
ttcggtatgaaatcaccgttgatgcaaacggaagacggtcaagtggaagaatcctattcc
atttcggcgggcttggatttcccttccgtggggccgcaacacgcctatttacaaagcatc
ggtcgtgcggaatacccaagtattaccgataatgaagcccttgacgcgttccaagcattg
gcaaaacacgaaggcattattcctgcgttagaaagctcccacgccctcgcccaagcctta
aaaatgatccgtcaggaaccaaataaagcgcaaattttggtggtgaatttgtccggtcgc
ggcgataaagatattttcaccgtagataaaattttaaatgaaaaaggaatgtaa

DBGET integrated database retrieval system