KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1733Help
Entry
ANH9381_1733      CDS       T01651                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANH9381_1733
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANH9381_1733
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANH9381_1733
Enzymes [BR:aao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ANH9381_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1634434..1635240
Genome map
AA seq 268 aa AA seqDB search
MSRFETTFAQLHAQNEGAFVPFVTLCDPTFDRSFDIICTLVDNEADALELGFPFSDPLLD
GPVIQAANNRALNAGHSTENSFKLLEKVRSKYPEIPMSLLLCANLIFAKGLDNFYQRCAD
VGVDAVLVADIPLLAKDDYVAAAKRHGIQPVFICPPNADEKTIQDVAQNSEGYTYLVSRA
GVTGAENQSHTANLDSLVERLKAHHAAPILQGFGIAQPAQVKEALQLGAAGAISGSATVK
IIARNLDNHAQCLTELGEFVRNMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaaccacatttgcccaattacacgcgcaaaatgaaggcgcattcgtt
cctttcgtgaccttatgcgacccgactttcgaccgttcttttgacattatttgcaccctg
gtggataacgaggcggacgcattggaactgggttttccgttctccgatcccttattggac
ggaccggtgattcaagccgccaacaatcgtgcgttaaacgccggtcacagcacggaaaac
agctttaaattgctggaaaaagtgcggtcaaaatatccggagattccgatgagtttgctg
ctttgcgccaatttaatttttgccaaaggcttggataatttttatcagcgttgcgccgac
gtgggcgtggacgccgtgttggttgccgatattccgttgttggcgaaagacgattatgtc
gccgccgcgaaaagacacggtattcaacccgtttttatttgcccgccgaatgcagacgaa
aaaaccattcaagatgtggcgcaaaatagtgaaggttacacgtatttggtttcccgcgcg
ggcgtgaccggtgcagaaaatcaaagccatacggcgaatctggacagcttagtagaacga
ctcaaagcccaccacgccgcgccaattctgcaaggcttcggcatcgcccaaccggcgcag
gtaaaagaagcactgcaactgggcgcggcaggggcgatttccggttccgctacggtgaaa
atcattgcgcgaaatttggataaccacgcccaatgtttaactgaactcggcgaattcgta
cgcaatatgaaagcggcgacgaaataa

DBGET integrated database retrieval system