KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1733Help
Entry
ANH9381_1733      CDS       T01651                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
aao00260  Glycine, serine and threonine metabolism
aao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aao01100  Metabolic pathways
aao01110  Biosynthesis of secondary metabolites
aao01130  Biosynthesis of antibiotics
aao01230  Biosynthesis of amino acids
Module
aao_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANH9381_1733
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANH9381_1733
Enzymes [BR:aao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ANH9381_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO
Motif
Other DBs
NCBI-ProteinID: AEW77667
Position
1634434..1635240
Genome map
AA seq 268 aa AA seqDB search
MSRFETTFAQLHAQNEGAFVPFVTLCDPTFDRSFDIICTLVDNEADALELGFPFSDPLLD
GPVIQAANNRALNAGHSTENSFKLLEKVRSKYPEIPMSLLLCANLIFAKGLDNFYQRCAD
VGVDAVLVADIPLLAKDDYVAAAKRHGIQPVFICPPNADEKTIQDVAQNSEGYTYLVSRA
GVTGAENQSHTANLDSLVERLKAHHAAPILQGFGIAQPAQVKEALQLGAAGAISGSATVK
IIARNLDNHAQCLTELGEFVRNMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaaccacatttgcccaattacacgcgcaaaatgaaggcgcattcgtt
cctttcgtgaccttatgcgacccgactttcgaccgttcttttgacattatttgcaccctg
gtggataacgaggcggacgcattggaactgggttttccgttctccgatcccttattggac
ggaccggtgattcaagccgccaacaatcgtgcgttaaacgccggtcacagcacggaaaac
agctttaaattgctggaaaaagtgcggtcaaaatatccggagattccgatgagtttgctg
ctttgcgccaatttaatttttgccaaaggcttggataatttttatcagcgttgcgccgac
gtgggcgtggacgccgtgttggttgccgatattccgttgttggcgaaagacgattatgtc
gccgccgcgaaaagacacggtattcaacccgtttttatttgcccgccgaatgcagacgaa
aaaaccattcaagatgtggcgcaaaatagtgaaggttacacgtatttggtttcccgcgcg
ggcgtgaccggtgcagaaaatcaaagccatacggcgaatctggacagcttagtagaacga
ctcaaagcccaccacgccgcgccaattctgcaaggcttcggcatcgcccaaccggcgcag
gtaaaagaagcactgcaactgggcgcggcaggggcgatttccggttccgctacggtgaaa
atcattgcgcgaaatttggataaccacgcccaatgtttaactgaactcggcgaattcgta
cgcaatatgaaagcggcgacgaaataa

DBGET integrated database retrieval system