KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1772Help
Entry
ANH9381_1772      CDS       T01651                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ANH9381_1772
Enzymes [BR:aao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ANH9381_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1671018..1672997)
Genome map
AA seq 659 aa AA seqDB search
MLALLSQLKEKGIINAADYYFAEFIHRKQQPFHYASSIQNLAVLMAALCNFSYRQGNTCI
LLNHATEQDLFGLQDYFNERVYLTDIQQKIDYLPIERWQAALLAAQHIAFTAAPLQQIAP
LVLQFERLYFYRIWQDEFRIADYFKSAVRFQHVFSAEQTAQIAPILNRYFYEEQGIDWQK
IAVAMALRQRFCLITGGPGTGKTTTVTKLLLTLQELHQNGLRIKLVAPTGKAAARLTESI
VDAVDRLKQTFSTEKHEREIIENLRIPMNAETIHRLLGVRFFSEETRYHVDNPLPVDVLV
VDEASMIDLTLMAKLLNALKPETKLILLGDKDQLASVEAGGILGELGRFVNASAPTYSLV
MTRYLQATTGSSLAASDSVNPIGDSICYLQVSRRFGANPEVGALAAAVNSGDAVKSWQLL
QQYQQYQAKKCGVYLTDFAHYLNNKEDIQQRKTCVKLIVERAAEEYRRYLQLILQEGQMD
EEKVRSIFAAFNGIRFLAALRVGEFGVEQLNLAIAEKLRQKRLLQFHQEREWYIGKPIMV
TQNDGNVGLYNGDIGMYLGNGRVWFEQGQNSYKTVLASRVPNHETAFVMTVHKSQGSEFP
HTFLILPLENSPVLSKELVYTGITRTKDFLTVFALQSVWESAVKNPVQRQSGLGQLLEI
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgttagctttattatcccaactcaaagaaaagggcatcatcaacgccgctgactattat
ttcgccgagtttattcaccgcaaacaacagccttttcactatgcatcgtctatccagaac
ctggcggtgcttatggcggcgttgtgcaacttcagttatcggcagggcaacacctgtatt
ttactgaatcacgccacggagcaggatttgttcggtttacaggattattttaacgaacgc
gtttatttaacggatattcagcaaaaaattgattatttgcccattgaacgctggcaggca
gccttgctggcggcgcaacatatcgctttcaccgccgcgcctttgcaacagatcgcgccc
ctggtgttgcagtttgagcgcttgtatttttatcgcatctggcaggatgagtttcgtatc
gccgattactttaaaagtgcggtccgttttcaacacgttttttcagccgaacagacggcg
caaatcgccccgattttgaaccgctatttttatgaagaacagggcatcgactggcaaaaa
atcgcggtggcgatggcattgcgtcaacgattttgcctcattaccggcgggccgggcacg
ggcaaaaccactaccgtcaccaaactcctattgaccttgcaggagcttcatcaaaacggc
ttgcgcattaaacttgtcgccccgacagggaaagcggcggcgcggcttacggaatccatt
gtggacgcggtagatcgcctgaaacagactttttccacggaaaaacacgagcgagaaatc
atcgaaaatctgcgcattcccatgaatgcggaaaccattcatcgcttgctcggcgtgcgt
tttttcagtgaggaaacccgctatcatgtcgacaatcctttgcccgtggatgtgttggtg
gtggacgaagcatccatgatcgatttaaccttgatggcgaagctgctcaatgcccttaaa
ccggaaaccaaattgattttattgggtgataaagatcagctggcttctgtagaagccggg
gggattttgggtgaattagggcgtttcgtgaatgcgtcggcgccgacgtatagcctcgta
atgacacgatatttacaggcgaccacgggcagttctcttgctgcgtcggatagcgtcaat
cctatcggtgatagcatttgttatttgcaggtcagccgccgtttcggggcaaatccggaa
gtgggtgcgttggcggctgcggtgaattcaggcgacgcggtgaaaagctggcagttattg
cagcaatatcagcaatatcaagcaaaaaaatgcggcgtatatttaacggattttgctcat
tatttaaataacaaagaagatattcagcaacgtaaaacctgcgtgaagctcatcgtggaa
cgtgcggcagaggaatatcgccgttatttgcagttgattttacaagaagggcagatggat
gaagaaaaagtgcggtcgattttcgcggcgtttaacggcattcgttttttagcggcgttg
cgtgtgggcgaattcggcgtggagcaattaaatctcgccatcgcagaaaaattacgccaa
aaacgcctgttgcaatttcatcaggaacgggaatggtacatcggcaaaccgattatggtg
acgcaaaatgatggcaatgtgggcttgtataacggtgacatcggcatgtatttgggaaac
ggacgggtatggttcgagcagggacaaaacagttataaaactgtgctggcaagccgcgtg
ccgaatcatgaaaccgccttcgtcatgacggtacacaaatcccaaggttcggaatttccg
catactttcctgattttgccattggaaaacagccccgtgttatccaaagaactggtttac
accggcatcacccgcaccaaggattttttaacggtgttcgcgctacaaagcgtatgggaa
agtgcggtgaaaaatccggtgcaacggcaaagcggattgggtcaattactggaaatctaa

DBGET integrated database retrieval system