KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1813Help
Entry
ANH9381_1813      CDS       T01651                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ANH9381_1813
Enzymes [BR:aao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ANH9381_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1712846..1713484)
Genome map
AA seq 212 aa AA seqDB search
MLQGNLYIISAPSGAGKSSLIAALLKQNNNHKMMVSVSHTTRQSRPGEQEGVHYYFVSQG
EFETLIEQNAFLEYAKVFGGNYYGTSLFAIEENLAKGIDVFLDIDWQGAQQIRKKVPNVK
SIFVLPPSLDELERRLIGRGQDSADVIADRMAKAMSEISHYNEYDYVIVNDNFEQALVDL
QAILRAERLTLAHQQQENQGLIEQLLEKSAAF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaggcaatttgtatatcatttcggcacccagcggtgcaggtaaatcttcatta
atcgccgcattgttaaaacaaaataataaccataaaatgatggtatccgtttcccacacc
accagacagtcgcgcccgggcgaacaagaaggcgtgcattattattttgtttctcaaggg
gaatttgaaaccttaatcgaacaaaatgcctttttggaatacgcgaaagtctttggcggc
aattattacggcacgtctttattcgctattgaagaaaatttagctaaaggcattgatgtt
tttttggatattgattggcagggcgcacaacaaattcgcaaaaaagtgccgaatgttaag
agtatttttgttttaccgccgtcgttggatgaattggaaagacgcttaatcggacgcggt
caggacagtgcggacgtgattgccgacagaatggcgaaagcgatgagcgaaatttctcat
tacaatgaatatgattatgtgatcgtcaacgataattttgaacaggcgcttgtggatttg
caggcaattctgcgtgctgagcgattgacattggcgcatcagcagcaagaaaatcaaggc
ctgattgaacaactactggaaaaatcagctgcattctag

DBGET integrated database retrieval system