KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1864Help
Entry
ANH9381_1864      CDS       T01651                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANH9381_1864
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANH9381_1864
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ANH9381_1864
Enzymes [BR:aao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ANH9381_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1753910..1755184
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKDQGLFFPQNIPHLTNIDELLALPLIERSQKILGAL
IGEEIPPAQLEQVVRNAFTFPAPVVKVEDNIYALELFHGPTLAFKDFGGRFMAQALATVR
GDGKITILTATSGDTGAAVAHAFYGLDNIEVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAAAQLPKKQRENLV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIAATNANDTVPRYLHSGNWSPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWTLTELHSAAISDGQTEETLRAMHKLGYLCEPHGAVAYEVLK
QDLQTGETGLFLCTAHPAKFKESVERILDLTLPLPEALDKHNKLPLLSDEMENDFAQLRA
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacatcaaacaccccgaagaacaagtcaatttcgctcaagcagtgcgc
caagggttaggcaaagatcaaggcttatttttcccgcaaaacataccgcacttaacgaat
atcgacgaactgttggcattgccgttgattgaacgcagccaaaaaattctcggtgcgtta
atcggtgaagaaatcccgccggcacagcttgaacaagtggtgcgcaacgccttcaccttc
cccgcgccggtggtgaaagtggaagacaatatttatgcgctagaattattccacggaccg
acactcgcctttaaagatttcggcggacgcttcatggcgcaagctttagccaccgtacgc
ggtgatggcaaaatcaccattttaaccgccacttccggcgacaccggcgcggcggtagct
catgccttctacggtttagacaatattgaagtggtgattttatatccgaaaggcaaaatc
agcccgttacaggaaaaactcttctgcaccctcggcggcaatattcgcaccgtcgctatc
aacgccgatttcgatgcttgccaagcgttagtgaaacaagcttttgatgacgccgaatta
cgtcaagccatcggcttaaactctgccaattccatcaatatcagccgcttattggcgcaa
gtgtgctattactttgaagcggcggcgcaattaccgaaaaaacagcgtgaaaatctcgta
gtctccgtgccaagcggcaacttcggcaacctcaccgccggcttaatcgccaaaaccctt
ggcttgccgatcaaacgctttatcgccgccaccaatgcaaacgacaccgtgccgcgctat
ttacacagtggcaactggtcaccgaacgccaccgttgccaccctttccaacgccatggac
gtttcccgcccgaataactggccgcgtgtggaagaattgttcaaacgtaacggctggaca
ttaaccgaattacattccgccgccatttccgatgggcaaacggaagaaacattacgcgca
atgcacaaactcggttatttatgcgagccgcacggcgcggtggcgtatgaggtgcttaaa
caggatttacaaacgggtgaaaccggtttattcctttgcaccgcccacccggcgaaattc
aaggaatctgttgagcgcattctggatttaaccctgccattgccggaagccttggataaa
cataacaaactgccgttgttatccgatgaaatggaaaacgattttgcgcagttaagagct
tatttgttgaaataa

DBGET integrated database retrieval system