KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1864Help
Entry
ANH9381_1864      CDS       T01651                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aao01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aao00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:aao00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1753910..1755184
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKDQGLFFPQNIPHLTNIDELLALPLIERSQKILGAL
IGEEIPPAQLEQVVRNAFTFPAPVVKVEDNIYALELFHGPTLAFKDFGGRFMAQALATVR
GDGKITILTATSGDTGAAVAHAFYGLDNIEVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAAAQLPKKQRENLV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIAATNANDTVPRYLHSGNWSPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWTLTELHSAAISDGQTEETLRAMHKLGYLCEPHGAVAYEVLK
QDLQTGETGLFLCTAHPAKFKESVERILDLTLPLPEALDKHNKLPLLSDEMENDFAQLRA
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacatcaaacaccccgaagaacaagtcaatttcgctcaagcagtgcgc
caagggttaggcaaagatcaaggcttatttttcccgcaaaacataccgcacttaacgaat
atcgacgaactgttggcattgccgttgattgaacgcagccaaaaaattctcggtgcgtta
atcggtgaagaaatcccgccggcacagcttgaacaagtggtgcgcaacgccttcaccttc
cccgcgccggtggtgaaagtggaagacaatatttatgcgctagaattattccacggaccg
acactcgcctttaaagatttcggcggacgcttcatggcgcaagctttagccaccgtacgc
ggtgatggcaaaatcaccattttaaccgccacttccggcgacaccggcgcggcggtagct
catgccttctacggtttagacaatattgaagtggtgattttatatccgaaaggcaaaatc
agcccgttacaggaaaaactcttctgcaccctcggcggcaatattcgcaccgtcgctatc
aacgccgatttcgatgcttgccaagcgttagtgaaacaagcttttgatgacgccgaatta
cgtcaagccatcggcttaaactctgccaattccatcaatatcagccgcttattggcgcaa
gtgtgctattactttgaagcggcggcgcaattaccgaaaaaacagcgtgaaaatctcgta
gtctccgtgccaagcggcaacttcggcaacctcaccgccggcttaatcgccaaaaccctt
ggcttgccgatcaaacgctttatcgccgccaccaatgcaaacgacaccgtgccgcgctat
ttacacagtggcaactggtcaccgaacgccaccgttgccaccctttccaacgccatggac
gtttcccgcccgaataactggccgcgtgtggaagaattgttcaaacgtaacggctggaca
ttaaccgaattacattccgccgccatttccgatgggcaaacggaagaaacattacgcgca
atgcacaaactcggttatttatgcgagccgcacggcgcggtggcgtatgaggtgcttaaa
caggatttacaaacgggtgaaaccggtttattcctttgcaccgcccacccggcgaaattc
aaggaatctgttgagcgcattctggatttaaccctgccattgccggaagccttggataaa
cataacaaactgccgttgttatccgatgaaatggaaaacgattttgcgcagttaagagct
tatttgttgaaataa

DBGET integrated database retrieval system