KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_2049Help
Entry
ANH9381_2049      CDS       T01651                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Brite
Enzymes [BR:aao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ANH9381_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1939541..1940923
Genome map
AA seq 460 aa AA seqDB search
MKKFALKTAVVAIVGYLGVVGYVHQYDKGQMEKLLAEGSYSAEQQKIAKVFFNNGCQYCH
TPNAELPFYAHVPLVGSMLQNDIKEGNRVFLLNELLNGLKDPSKLSEVDLAKLERVIEND
EMPIAKFLHIHWGSRPDEDEKTALLNWIREQRKAFLPANTEGTDNHRLVQPIPDEIMTDA
AKVALGHKLFMDGRLSGDGTIQCHTCHQLDKGGVDRLDTSTGIDGKKGGINAPTVFNAAF
NFAQFWDGRAVDLADQAGGPPLNPVEMGSHSWEEIVARFEQDEDFKQAFLQVYPQISKET
LTNAIGEYEKTLITPNSDFDRYLKGENTLTAQQLKGYELFKQYKCDTCHTGVNMGGQSYE
YMGIYGDYFKDRGTPLTDADQGRFAQTQDPYDMHRFKVPSLRNIALTAPYMHDASAKDLK
EAVRIMLKYQSNAKPQQQDIDDITSFLESLTGEFEGKKLQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgcactgaaaacggcggttgtcgctattgttggctatttaggagttgta
gggtacgttcatcagtatgataaaggacaaatggaaaaattattggctgaaggtagttac
tctgccgagcaacaaaaaatcgcaaaagtcttttttaacaacggctgccagtactgtcat
acaccaaatgcagaactccccttttatgcccatgttccgttagttggctccatgttgcaa
aatgacatcaaagaaggcaaccgcgtattcctgttaaatgagttactgaacggcttaaaa
gatccaagcaaattatcggaagtggatttggcaaaacttgaacgggttattgaaaatgac
gaaatgccgattgccaagtttcttcatattcactggggaagccgccctgatgaagatgaa
aaaaccgcattgctaaactggattcgcgaacaacggaaagcctttttaccggcaaatacc
gaaggcacggacaaccaccgtttagttcaaccgattcctgatgaaatcatgaccgatgcg
gcaaaagttgctcttgggcataaactgtttatggatggtcgtttatccggcgatggtacg
attcaatgtcacacctgccaccaactggacaaaggcggtgttgaccgtttagatacatcc
accggcattgatggcaaaaaaggcggcattaacgcgccgactgtcttcaacgccgcattt
aacttcgcacaattctgggatgggcgtgccgtggatttagccgatcaagccggcggaccg
ccattaaatccggtagaaatgggttcccattcctgggaagaaattgtggcacgatttgag
caggatgaagattttaaacaagcgttcttacaagtctatccgcaaatcagcaaagaaacc
ctcaccaatgctatcggtgaatatgaaaaaaccttaattacaccgaacagcgattttgac
cgctatctgaaaggcgaaaacacattaaccgcgcaacaacttaaaggttacgagctattt
aaacagtacaaatgcgacacctgccacactggcgtgaacatgggcggacaatcttacgaa
tacatgggtatctacggcgattatttcaaagatcgcggcacaccgctcactgatgccgac
caaggtcgtttcgcacaaactcaagatccgtatgatatgcaccgtttcaaagtgccatca
ctgcgcaatattgcgttaacggcgccttatatgcacgatgcgtcggcaaaagatctgaaa
gaagccgttcgtatcatgttgaaatatcaaagcaatgctaaaccgcagcaacaagacatt
gatgacattacgtccttcttggaaagtctcaccggcgagtttgaaggcaaaaaattacaa
taa

DBGET integrated database retrieval system