KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_2055Help
Entry
ANH9381_2055      CDS       T01651                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANH9381_2055
Enzymes [BR:aao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ANH9381_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947297..1948115
Genome map
AA seq 272 aa AA seqDB search
MINIQRQQQITPELSLYTYNEIPVLHLQHAIGTAKIALQGAHLFSWQPAHSKQDVLWLSE
IEPFETSTAIRGGIPICYPWFNKAGTPAHGFARISLWQLSDYAINADKVRLVFSLFSAHN
VILAKVEMIFGKHCDLRFTHYGEAGMEKVQLALHSYFNIGNITHTDIANLPTECFNALTR
QQESVPSPRHIAENVDCVYTTQQPTEIRDYDNQRTIIVEHHNAGDVVLWNPWHKPTGNMT
ENGYQTMVCVETARINRYLDAGETVAVRLRVE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatattcaacgacaacaacaaatcacgcccgaactgagcttatatacctataac
gaaattcccgttttacatttacaacacgccataggcacggcaaaaatcgccttacaaggg
gcgcatttattcagctggcagccggcgcacagtaaacaggacgtgctgtggctaagtgaa
atcgaaccctttgaaaccagcacggcaattcgcggcggcattcctatttgttatccgtgg
tttaataaagccggcacacctgcccacgggttcgcccgtatcagcctgtggcagttgagc
gattacgcaattaatgccgataaagtgcggttggttttttcgttgttttccgcgcacaat
gtgattttagcgaaagtagaaatgattttcggcaaacattgtgacttgcgctttacccat
tacggtgaagcaggaatggaaaaagtgcagctggcgttacacagttatttcaacatcggt
aatatcacccataccgacatcgccaacctgccgacggaatgcttcaacgccctcacccgc
caacaagaaagcgtgccgtcaccacgccatattgcggaaaatgtggattgtgtttacacc
acccaacaaccgacggaaattcgcgactatgacaatcaacgcacaatcattgtggaacat
cacaatgccggcgatgtggtactgtggaacccatggcacaaacctaccggtaacatgaca
gaaaacggctatcaaactatggtctgcgtggaaacggcacgaatcaatcgctatcttgat
gcaggggaaacggtggcggtgagattgcgtgtggaataa

DBGET integrated database retrieval system