KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_2130Help
Entry
ANH9381_2130      CDS       T01651                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
aao00020  Citrate cycle (TCA cycle)
aao00640  Propanoate metabolism
aao00660  C5-Branched dibasic acid metabolism
aao01100  Metabolic pathways
aao01110  Biosynthesis of secondary metabolites
aao01120  Microbial metabolism in diverse environments
aao01130  Biosynthesis of antibiotics
aao01200  Carbon metabolism
Module
aao_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANH9381_2130
   00640 Propanoate metabolism
    ANH9381_2130
   00660 C5-Branched dibasic acid metabolism
    ANH9381_2130
Enzymes [BR:aao01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ANH9381_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ydhR ATP-grasp PSI_PsaE
Motif
Other DBs
NCBI-ProteinID: AEW78018
Position
complement(2018048..2019217)
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQSKQVFAEYDLPICRGIACKTADEAAEAIKQLKGDVWVTKCQVHAGGRGKAGGV
KLVRNEAEVRAFVDKWLGQRLVTFQTDANGQPINIIYVEETVNIDRELYLGAVIDRASQK
VVFMASAAGGMDIEEVAAKTPELLHKVALDPLVGGMPYQGRELAFKLGLKGDQINQFTHI
FTQLAKMFVERDLSLLEINPLVVTKEGKLSCLDAKIVVDSNALYRQLDLATMHDITQSDA
REALAELHQLNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGQPANFLDVGGGTTKERVAE
AFKIILSDKNVKAVLVNIFGGIVRCNLIAEGIVAAVNQVGVHVPVVVRLEGNNAPLGREI
LANSGLNIIAAKTLTDAAVESIKAANGNL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacacgaataccaaagtaagcaggtttttgccgaatatgatttaccgatatgc
cgaggcatcgcttgtaaaaccgcagacgaagcggcagaggcgatcaaacagctgaagggc
gatgtttgggttaccaagtgccaagtgcatgcgggtgggcgcggaaaagccggtggcgtg
aaattggtgcgtaatgaagcggaagtgcgtgcctttgtggataaatggctggggcagcgt
ttggtgacctttcaaaccgatgccaatgggcaaccgattaacattatttatgtggaagaa
acggtcaatatcgaccgagagttatatttgggcgcggtgatcgatcgcgcttcacaaaaa
gtggtctttatggcatctgccgccggcggtatggatattgaagaggtggcggcgaaaacc
ccggaattattgcataaagtagcgttggatccgctggtgggcggaatgccttatcaaggg
cgcgaattggcgtttaaactggggttgaagggcgatcaaatcaaccaatttacccatatt
ttcacccaactggcgaaaatgtttgtagagcgggatttatctctgttggaaattaatccg
cttgtagtaaccaaagaaggcaagctgtcttgtctggatgccaagatcgtggtggacagt
aatgcactatatcgccagctggatttagccactatgcacgatattacccaaagcgatgcg
cgtgaagccttggcggagttgcaccagctgaattacgtagcactggacggcaacatcggc
tgtatggtcaatggcgccgggcttgccatgggcacgatggatattgtgaaactgcacggc
gggcagcctgcaaatttccttgatgtgggcggtggcacaaccaaagaacgggtggcggaa
gccttcaaaatcattctttccgataaaaacgtcaaagccgtattggtgaatattttcggc
ggcattgtgcgttgcaatctgatcgccgaaggcattgtggcggcggtgaaccaagtgggc
gtacatgtgccggtagtggtgcgtttggaaggcaacaacgcgcctttaggacgggaaatt
ttagccaacagcggtttgaatattattgcggcgaaaaccctcacggacgcggcggtggaa
tccattaaagcggcaaatggtaatttataa

DBGET integrated database retrieval system