KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_2132Help
Entry
ANH9381_2132      CDS       T01651                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
aao00020  Citrate cycle (TCA cycle)
aao00310  Lysine degradation
aao01100  Metabolic pathways
aao01110  Biosynthesis of secondary metabolites
aao01120  Microbial metabolism in diverse environments
aao01130  Biosynthesis of antibiotics
aao01200  Carbon metabolism
Module
aao_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANH9381_2132
  Amino acid metabolism
   00310 Lysine degradation
    ANH9381_2132
Enzymes [BR:aao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ANH9381_2132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEW78020
Position
complement(2019404..2020627)
Genome map
AA seq 407 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGVLAQIL
QEEGATVVSKQLLGTLEDSVTAAAIATEKTAEPTPKDRRTEVPDEPHVTDAQGPAVRRLL
AEHGLQPSDVADVKGTGVGGRITREDVEAILAQRTAAAAQPQVAEDTLSTVAYAARSEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKQYGEKFEKQHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVTPVLRDCDNLSMADIEKS
IKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPVAL
NGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaaattcttgtccccgatttacccgaatccgtagccgatgccaccgtggca
acttggcacaaaaaagcgggcgacgcagtgaaacgtgatgaagtgattgtggaaatcgag
accgacaaagtggtgcttgaagtgccggcacaggcggacggcgtgcttgcccagattttg
caggaagaaggggcaacagtagtcagcaaacagttgcttggcactctggaagattcggtg
acggcggcagccattgcaacggaaaaaacggcggagccgacaccgaaagatcgtcgcacg
gaagtgcctgatgaaccgcatgtcaccgatgcgcaaggacctgcggtacgccgtttatta
gccgagcacggtttacagccttccgatgttgccgatgtaaaaggcaccggcgtgggcggc
agaattacccgtgaagatgtggaagcgatccttgcccaacgcacggctgcagcggcacaa
ccgcaagtggcggaagataccctcagcaccgtggcatatgccgcacgtagtgaaaaacgc
gtgccgatgacccgtttacgcaaacgtattgcggaacgtctgttggaagccaaaaacacc
accgcgatgttgactacgttcaatgaagtggatatgcagccgatcatgaacctgcgtaaa
caatacggtgaaaaatttgaaaaacaacacggcgtgcgtttaggcttcatgtctttttat
atcaaagccgtggtggaagccttaaaacgttatccggaagtgaatgcctccattgacggc
gacgatgtgatttatcacaactattttgacgtgagcattgcggtttcgactccacgcggt
ttagtgacgccggtattgcgcgattgtgataatctttccatggcggacattgaaaaatct
atcaaagccctggcggaaaaagggcgtgacggcaaattgacagtagaagatttaaccggc
ggtaacttcaccattaccaacggcggcgtgttcggttcgctaatgtccactccgattatc
aacccgccgcaaagtgccattttaggtatgcacgccattaaagaacgcccggtggcgcta
aacggtcaagtggtgattcgcccgatgatgtatttggcattgagttacgaccaccgctta
attgacgggcgggaatccgtcggtttcttagtgacgataaaagagctgctggaagacccg
acaagattattacttgaaatttaa

DBGET integrated database retrieval system