KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_2132Help
Entry
ANH9381_2132      CDS       T01651                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:aao01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aao00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aao00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2019404..2020627)
Genome map
AA seq 407 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGVLAQIL
QEEGATVVSKQLLGTLEDSVTAAAIATEKTAEPTPKDRRTEVPDEPHVTDAQGPAVRRLL
AEHGLQPSDVADVKGTGVGGRITREDVEAILAQRTAAAAQPQVAEDTLSTVAYAARSEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKQYGEKFEKQHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVTPVLRDCDNLSMADIEKS
IKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPVAL
NGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaaattcttgtccccgatttacccgaatccgtagccgatgccaccgtggca
acttggcacaaaaaagcgggcgacgcagtgaaacgtgatgaagtgattgtggaaatcgag
accgacaaagtggtgcttgaagtgccggcacaggcggacggcgtgcttgcccagattttg
caggaagaaggggcaacagtagtcagcaaacagttgcttggcactctggaagattcggtg
acggcggcagccattgcaacggaaaaaacggcggagccgacaccgaaagatcgtcgcacg
gaagtgcctgatgaaccgcatgtcaccgatgcgcaaggacctgcggtacgccgtttatta
gccgagcacggtttacagccttccgatgttgccgatgtaaaaggcaccggcgtgggcggc
agaattacccgtgaagatgtggaagcgatccttgcccaacgcacggctgcagcggcacaa
ccgcaagtggcggaagataccctcagcaccgtggcatatgccgcacgtagtgaaaaacgc
gtgccgatgacccgtttacgcaaacgtattgcggaacgtctgttggaagccaaaaacacc
accgcgatgttgactacgttcaatgaagtggatatgcagccgatcatgaacctgcgtaaa
caatacggtgaaaaatttgaaaaacaacacggcgtgcgtttaggcttcatgtctttttat
atcaaagccgtggtggaagccttaaaacgttatccggaagtgaatgcctccattgacggc
gacgatgtgatttatcacaactattttgacgtgagcattgcggtttcgactccacgcggt
ttagtgacgccggtattgcgcgattgtgataatctttccatggcggacattgaaaaatct
atcaaagccctggcggaaaaagggcgtgacggcaaattgacagtagaagatttaaccggc
ggtaacttcaccattaccaacggcggcgtgttcggttcgctaatgtccactccgattatc
aacccgccgcaaagtgccattttaggtatgcacgccattaaagaacgcccggtggcgcta
aacggtcaagtggtgattcgcccgatgatgtatttggcattgagttacgaccaccgctta
attgacgggcgggaatccgtcggtttcttagtgacgataaaagagctgctggaagacccg
acaagattattacttgaaatttaa

DBGET integrated database retrieval system