KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_2191Help
Entry
ANH9381_2191      CDS       T01651                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aao00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ANH9381_2191
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANH9381_2191
   00620 Pyruvate metabolism
    ANH9381_2191
   00650 Butanoate metabolism
    ANH9381_2191
  Lipid metabolism
   00071 Fatty acid degradation
    ANH9381_2191
  Amino acid metabolism
   00350 Tyrosine metabolism
    ANH9381_2191
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ANH9381_2191
   00626 Naphthalene degradation
    ANH9381_2191
Enzymes [BR:aao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ANH9381_2191
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ANH9381_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2082945..2085566
Genome map
AA seq 873 aa AA seqDB search
MSNVENAVSPAQAEVNALVEKGLVALEEFRQLNQEQVNYIVAKASVAALDQHGVLAMHAY
EETGRGVFEDKATKNLFACEYVVNNMRHLKTVGVISENDVTGITEIADPVGVICGITPTT
NPTSTAIFKSLIALKTRNPIIFAFHPSAQQSSAHAARIVYEAAIAAGAPKNCIQWIEKPS
MEGTSALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKSANLKQAVHDI
VMSKSFDNGMVCASEQAAIVDEEIYNDFVKEMLSYGVYMVNKKEKAMLEEFMFGTKANSK
NCGGAKLNANVVGKPAAWIAEQAGFKVLPRTNILLAECKEVGEKEPLTREKLSPVLALIK
STSREDGLEKAEQMVEFHGLGHSAAIHTSDAELAKEFGKRVKAIRVIWNSPSTFGGIGDV
YNAFLPSLTLGCGSYGKNSVGNNVSAVNLINIKRVGRRRNNMQWFKVPSKIYFERDSIQY
LQSMGGMERVVIVTDRTMVDLGFVEKIAHQITARGNHVTYQLFADVEPDPSIETVRRGTE
LIRNYKPDTIIALGGGSAMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGRKA
RFIGIPTTSGTGSEVTPFAVITEGNKKYPIADYSLTPTVAIVDPALVITVPAHVAADTGL
DVLTHATEAYVSILASDFTDGLALQAIKLVFEFLEKSVTEKDQEARERMHNASTMAGMAF
ANAFLGMNHSLAHKIGGRFHTPHGRTNAILMPHVIRYNGTRPEKTATWPKYNYYKADVKY
QDIARMLGLPCSTPEEGVRSYAQACYDLAVRCGIKMSFKEQGLDEKAWMDARRDVALLAF
EDQCSPANPRLPMVTDMEDILTRAYFGYDPKDY
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgttgaaaatgcagtaagtcctgcacaagcagaagtgaatgctctggttgaa
aaaggtttggttgcgctggaagaattccgccaattaaaccaagagcaggtgaactacatt
gtggcgaaagcctctgtggcggcgctggatcaacatggtgtgctggcaatgcacgcttat
gaagaaaccgggcgtggcgtatttgaggataaagcgaccaaaaatttattcgcctgtgaa
tatgtcgtgaacaatatgcggcatttaaaaaccgtcggcgtaataagtgaaaatgatgta
acaggcatcaccgaaatcgccgatcctgtgggcgtcatctgtgggatcaccccgacaacc
aacccgacatccaccgccattttcaagtccctcattgcgctaaaaacccgtaacccaatc
atttttgccttccatccctccgcccaacaatcttccgcgcacgccgcccgcattgtgtat
gaagctgctattgccgccggtgcgccgaaaaattgtattcaatggatcgaaaaaccatct
atggaaggcacatccgcattaatgaaacacccgggcatcgccaccatccttgccaccggc
gggaacgccatggtagaagctgcttattcctgcggcaaaccggcattgggcgtcggtgca
ggtaacgtgccggcttatgtggaaaaatccgccaacttaaaacaagcagtgcacgacatc
gtgatgtccaaatccttcgataacggcatggtgtgcgcctccgaacaggcggccatcgtc
gatgaagaaatctataacgattttgtaaaagaaatgctttcttacggcgtttatatggtg
aacaagaaagaaaaagccatgctggaagaattcatgttcggcacaaaagccaacagcaag
aactgtggcggcgcgaaactgaatgccaatgtggtgggtaaacctgccgcctggattgcg
gaacaggcgggcttcaaagtgctaccgcgaaccaatattctgcttgccgaatgtaaagaa
gtgggcgaaaaagagccgctaacccgtgaaaaactttctccggtactggctttaattaaa
tctacctcccgtgaagacggtcttgaaaaagcggaacaaatggtggaattccatggtttg
ggtcactccgccgccattcacacctccgatgcggagcttgccaaagaatttggtaaacgg
gtgaaagccattcgcgttatctggaactcgccttccaccttcggcggtatcggtgatgtg
tataacgccttcctgccttccctcacgttaggttgtggttcttatggtaaaaattccgtg
ggcaacaacgtaagtgcggtcaatttaattaacattaaacgagtaggcagacggagaaac
aatatgcaatggtttaaagtgccgtcaaaaatctattttgaacgggattcaattcaatat
cttcaatccatgggcggcatggaacgcgtggtcatcgtcaccgaccgtaccatggtggac
ttaggtttcgtagaaaaaatcgcccaccaaattacggctcgtggcaatcacgtaacctac
caattatttgccgatgtagaaccggatccgtccattgaaaccgtacgccgtggtacggag
ttaatccgtaactacaaaccggataccattatcgccctgggtggtggttcggcaatggat
gcggcaaaagtgatgtggttattctatgaacaaccagaagtggatttccgcgatttggta
cagaaattcatggatatacgtaaacgcgcgtttaaattcccgcaactaggtcgtaaagcc
agatttatcggtattccgacaacatccggtaccggttctgaagtgacaccgtttgcggtt
atcaccgaaggtaataaaaagtacccgattgccgactactcgcttaccccgaccgtcgcc
attgtggatccggcattagtgatcactgtaccggcacatgtcgccgccgacaccggcttg
gacgtattaacccacgccaccgaagcttatgtatccattcttgccagcgacttcaccgat
ggtcttgccttgcaagccattaaactggtgtttgagttcctggaaaaatctgtgaccgaa
aaagatcaggaagcgcgcgaaagaatgcataacgcctccaccatggcaggtatggcattc
gccaatgcgtttttagggatgaaccactcccttgcccacaaaatcggcggtcgcttccat
acaccacacggacgcaccaacgcgattttaatgccgcacgtgattcgttataacggtacc
cgcccggaaaaaaccgctacgtggccgaaatataattactacaaagcagatgtaaaatac
caagacatcgcccgtatgctcggcttgccttgcagcacaccggaagaaggcgtgcgttct
tacgcacaagcctgctacgatttagctgtgcgttgtggcattaagatgtctttcaaagaa
caaggcttggatgaaaaagcgtggatggatgcccgtcgtgatgtggcactgctcgccttt
gaagaccaatgttccccggcaaaccctcgtttaccgatggttaccgatatggaagacatc
ctcacccgcgcttattttggttatgatccaaaggattattaa

DBGET integrated database retrieval system