KEGG   Aggregatibacter aphrophilus: NT05HA_0090Help
Entry
NT05HA_0090       CDS       T00929                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT05HA_0090 (tpiA)
   01230 Biosynthesis of amino acids
    NT05HA_0090 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT05HA_0090 (tpiA)
   00051 Fructose and mannose metabolism
    NT05HA_0090 (tpiA)
   00562 Inositol phosphate metabolism
    NT05HA_0090 (tpiA)
Enzymes [BR:aap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NT05HA_0090 (tpiA)
Exosome [BR:aap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NT05HA_0090 (tpiA)
  Exosomal proteins of bladder cancer cells
   NT05HA_0090 (tpiA)
  Exosomal proteins of melanoma cells
   NT05HA_0090 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91430..92221
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTRELITGLKEELHGVTGCDVAIAPPVMYLGEAEKLLSNCGC
SCGGQNIIQLGAQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINLLGVEAFNGTVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAKKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAAKAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggtaactggaaattaaacggtagtaaagccttcact
cgtgaattaatcaccggcttaaaagaagaattgcacggtgtgaccggctgtgacgtggca
attgccccaccggtgatgtatttgggggaagcagaaaaattattatccaactgcggttgc
agctgcggtggtcaaaatatcatccaattaggcgcacaaaacgtggatgtgaatgtgaaa
ggcgccttcaccggtgacatttccactgaaatgctaaaagattttggtgcgaaatacatt
attatcggtcactccgagcgtcgtacttatcacaaagaaagcgatgaatttgtggcgaaa
aaattcggtgcgttaaaagaagcgggcttagttcctgtattatgtatcggtgaatccgaa
gcggaaaatgaagcgggcaaaaccgaagaagtatgcgcacgtcaaattgatgcagtcatc
aacctgttaggcgtggaagccttcaacggtacggttatcgcttatgagccaatttgggct
atcggtaccggcaaatccgcgactccggcacaagcgcaagccgtacacgccttcatccgt
ggtcacattgcgaaaaaatcccaagcggttgccgatcaagtgatcattcaatacggcggt
tctgttaacgatgctaacgcagcagaattgtttacccaaccggatattgacggtgcatta
gtgggcggtgcgtccttaaaagcgcctgcctttgcggtgatcgtgaaagcagcggcaaaa
gcgaaaaactaa

DBGET integrated database retrieval system