KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0107Help
Entry
NT05HA_0107       CDS       T00929                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00010  Glycolysis / Gluconeogenesis
aap00030  Pentose phosphate pathway
aap00051  Fructose and mannose metabolism
aap00052  Galactose metabolism
aap00680  Methane metabolism
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01120  Microbial metabolism in diverse environments
aap01130  Biosynthesis of antibiotics
aap01200  Carbon metabolism
aap01230  Biosynthesis of amino acids
aap03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT05HA_0107
   00030 Pentose phosphate pathway
    NT05HA_0107
   00051 Fructose and mannose metabolism
    NT05HA_0107
   00052 Galactose metabolism
    NT05HA_0107
  Energy metabolism
   00680 Methane metabolism
    NT05HA_0107
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NT05HA_0107
Enzymes [BR:aap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NT05HA_0107
Protein phosphatases and associated proteins [BR:aap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NT05HA_0107
Messenger RNA biogenesis [BR:aap03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NT05HA_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACS96549
Position
106479..107444
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAVIRAVVRAGLSEGLEVYGIYDGYHGLYHNKIKQLTRYSVSD
IINRGGTFLGSARFPEFKNPEVRAKCADILRSYGIDALVVIGGDGSYMGAKLLTEEHGFP
CVGIPGTIDNDVAGTDYTIGYQTALQTAVEAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SSGIAGGCEYIVASEVEFNREELIRQIERSIIKGKRHAIIAITELICDVNELAKEIEARV
HHETRATILGHIQRGGSPCAFDRILGSRMGVYAIDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMHREFKADWLKMFKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagtgctaaccagtggcggtgacgccccgggaatgaatgcggta
atccgtgcagtagtgcgtgcgggcttgtcggaaggattggaagtttatggtatctatgat
ggctatcatggcttgtatcacaataaaatcaaacaattaacccgctatagtgtgtccgat
attattaaccgtggcggtacattcttaggttctgcacgtttcccggaatttaaaaatcct
gaggtacgtgccaaatgtgccgatattttacgttcttacggcattgacgctttagtggtt
atcggcggggacggttcttacatgggggcaaaattgcttaccgaagagcatggtttccct
tgcgtggggattcccggcactattgataatgatgttgcaggcaccgattacaccatcggc
tatcaaactgccttgcaaactgccgtggaagccattgaccgtttacgcgatacctcaagc
tctcaccaacgtatttctatcgttgaaatcatggggcggcattgtagcgacctcaccatt
tcttccggcatcgccggcggttgtgaatacatcgttgcctcggaagtggaatttaatcgc
gaagaactcattcgtcaaattgagcgtagtatcatcaaaggcaaacgccacgctatcatt
gctatcaccgagttaatttgtgatgttaatgagttagcaaaagaaattgaagcacgtgtt
catcatgaaactcgtgcaaccatcttaggtcacattcaacgtggcggctcaccttgtgcc
ttcgaccgaattctaggatcgcgtatgggcgtctatgccatcgacttgttgctccaaggc
aaaggcggctactgtgtgggcatccaaaacgaacaattggttcaccacgatatcatcgat
gccatcaataatatgcatcgcgaattcaaggcagattggttaaaaatgttcaaacgttta
gactaa

DBGET integrated database retrieval system