KEGG   Aggregatibacter aphrophilus: NT05HA_0107Help
Entry
NT05HA_0107       CDS       T00929                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT05HA_0107
   01230 Biosynthesis of amino acids
    NT05HA_0107
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT05HA_0107
   00030 Pentose phosphate pathway
    NT05HA_0107
   00051 Fructose and mannose metabolism
    NT05HA_0107
   00052 Galactose metabolism
    NT05HA_0107
  Energy metabolism
   00680 Methane metabolism
    NT05HA_0107
Enzymes [BR:aap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NT05HA_0107
Protein phosphatases and associated proteins [BR:aap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NT05HA_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106479..107444
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAVIRAVVRAGLSEGLEVYGIYDGYHGLYHNKIKQLTRYSVSD
IINRGGTFLGSARFPEFKNPEVRAKCADILRSYGIDALVVIGGDGSYMGAKLLTEEHGFP
CVGIPGTIDNDVAGTDYTIGYQTALQTAVEAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SSGIAGGCEYIVASEVEFNREELIRQIERSIIKGKRHAIIAITELICDVNELAKEIEARV
HHETRATILGHIQRGGSPCAFDRILGSRMGVYAIDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMHREFKADWLKMFKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagtgctaaccagtggcggtgacgccccgggaatgaatgcggta
atccgtgcagtagtgcgtgcgggcttgtcggaaggattggaagtttatggtatctatgat
ggctatcatggcttgtatcacaataaaatcaaacaattaacccgctatagtgtgtccgat
attattaaccgtggcggtacattcttaggttctgcacgtttcccggaatttaaaaatcct
gaggtacgtgccaaatgtgccgatattttacgttcttacggcattgacgctttagtggtt
atcggcggggacggttcttacatgggggcaaaattgcttaccgaagagcatggtttccct
tgcgtggggattcccggcactattgataatgatgttgcaggcaccgattacaccatcggc
tatcaaactgccttgcaaactgccgtggaagccattgaccgtttacgcgatacctcaagc
tctcaccaacgtatttctatcgttgaaatcatggggcggcattgtagcgacctcaccatt
tcttccggcatcgccggcggttgtgaatacatcgttgcctcggaagtggaatttaatcgc
gaagaactcattcgtcaaattgagcgtagtatcatcaaaggcaaacgccacgctatcatt
gctatcaccgagttaatttgtgatgttaatgagttagcaaaagaaattgaagcacgtgtt
catcatgaaactcgtgcaaccatcttaggtcacattcaacgtggcggctcaccttgtgcc
ttcgaccgaattctaggatcgcgtatgggcgtctatgccatcgacttgttgctccaaggc
aaaggcggctactgtgtgggcatccaaaacgaacaattggttcaccacgatatcatcgat
gccatcaataatatgcatcgcgaattcaaggcagattggttaaaaatgttcaaacgttta
gactaa

DBGET integrated database retrieval system