KEGG   Aggregatibacter aphrophilus: NT05HA_0109Help
Entry
NT05HA_0109       CDS       T00929                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aap  Aggregatibacter aphrophilus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NT05HA_0109
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NT05HA_0109
Enzymes [BR:aap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NT05HA_0109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(108735..109781)
Genome map
AA seq 348 aa AA seqDB search
MSTLLIDLAGLTLEQEEIELLEHPLVAGLILFSRNFHDRAQLQALIQSVRQKVKKPLLIT
VDQEGGRVQRFREGFTQLPAMQAFSALIKDSIQQQEMAFEAGWQMAAEMTALDIDLSFAP
VLDLGHQCKAIGDRSFGCKVKSAVDLAANFIRGMHQAGMAATGKHFPGHGHVIADSHLET
PYDERSQEDIFNQDIQPFQQLIEQNLLQAIMPAHVIYSQCDSQPASGSKYWLQDVLRRQL
NFNGAIFSDDLGMKGAGFMGDFVARSEQALNAGCDLLLLCNERDGVIQVLDNLKLSEKQP
HFLLRQQRLQGLFKRKNLTWSELECAPRWLENRKKLTALQQQWLATKD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccttactcattgatttagccggtttaacacttgagcaggaagaaattgaactg
cttgaacaccccttggttgccgggttaattttatttagtcgaaactttcacgaccgagct
caattgcaagcgttaattcaatccgtgcgacaaaaagtcaaaaaaccgttgctgattacc
gtggatcaagagggcggtcgggtacagcgtttccgcgaagggttcacccaattacctgcc
atgcaggcattttctgcgctgattaaagactctattcaacaacaagaaatggcatttgaa
gccggttggcaaatggcggcagaaatgaccgcacttgatattgatttgagctttgcgccc
gtgttggatctgggacaccaatgcaaagccatcggcgatcgcagttttggttgcaaagta
aaaagtgcggtggatttggcggctaatttcattcgcggtatgcaccaagccggcatggcc
gcgacaggaaaacactttccggggcatgggcatgtgattgcagattctcatttggaaacg
ccctatgacgaacgaagccaagaagacattttcaatcaggatattcagcccttccaacaa
cttatcgaacaaaatctgctgcaagccattatgccggcacatgtaatttattcgcaatgc
gacagccaaccggcaagtggctccaaatattggttacaggacgtcttacgccgtcaacta
aatttcaacggcgccattttctctgacgatctcggcatgaaaggagcgggattcatggga
gattttgtggcacgcagcgaacaagccttaaatgctggctgtgatttattgttgctttgt
aacgaacgggacggtgtgattcaagtgttggataacttaaaactctcggaaaaacaaccg
cactttttattacggcaacagcgtctgcaaggcctattcaaacgtaaaaaccttacctgg
tcggaactggaatgtgccccacgttggttagaaaatcgtaaaaaactgaccgcacttcaa
cagcaatggctggcgaccaaagattag

DBGET integrated database retrieval system