KEGG   Aggregatibacter aphrophilus: NT05HA_0139Help
Entry
NT05HA_0139       CDS       T00929                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT05HA_0139
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT05HA_0139
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NT05HA_0139
Enzymes [BR:aap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NT05HA_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(135950..137224)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKDQGLFFPENIPHLSNINELLTLPLVERSQKILSAL
IGEEIPQTQLEQMVRNAFTFPAPVVQVEDNIYALELFHGPTLAFKDFGGRFMAQALATVR
GDGKITILTATSGDTGAAVAHAFYGLENIDVVILYPKGKISPLQEKLFCTLGGNIRTIAI
NADFDACQTLVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAAAQLSKEQRENLV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIAATNANDTVPRYLHSGNWSPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWALSELHSAAISDAQTEDTLRAMNQLGYLCEPHGAVAYEVLK
QDLQADETGLFLCTAHPAKFKESVERILDLTLPLPEALDKHNKLLLLSDEMENDFAQLKA
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacaccctgaagaacaggtcaattttgcccaagctgtgcgc
caagggctaggcaaagatcaaggcttgtttttccctgaaaacataccgcacttaagcaat
atcaatgagctattgacattgccgctggttgaacgcagccaaaaaattctcagcgcatta
atcggtgaggaaatccctcagacacaacttgaacaaatggttcgtaacgcctttaccttc
cctgcgccggttgtacaggttgaagacaatatttatgcactggaattgttccatggccca
acccttgcctttaaagacttcggcggacgcttcatggcgcaagccttagccaccgtacgt
ggtgatggcaaaatcactattttaacggcaacatccggtgacaccggtgcagcagttgca
catgccttctacggattagaaaatatcgatgtggtgattttatacccgaaaggcaaaatc
agtccattacaggaaaaactcttctgcacccttggcggtaatattcgcactatcgctatc
aatgccgatttcgatgcctgccaaaccttggtgaaacaagcctttgacgatgcagaacta
cgtcaagctattggcttaaactcagcaaactccatcaatatcagccgtttattggcacaa
gtgtgctattactttgaagcggcggcacaattatcaaaagaacaacgtgaaaacttggtg
gtttccgtgccaagcggcaacttcggcaacctcactgcagggttaatcgccaaaaccctc
gggttgccgattaaacgctttatcgccgccaccaacgctaacgacaccgtgccgcgttat
ttgcacagcggaaactggtcgccaaatgcgactgtggccactctttccaacgccatggac
gtttctcgtccaaacaactggcctcgcgtagaagaattgttcaaacgcaacggttgggcg
ttaagtgagctacattctgccgcaatttccgatgcgcaaacagaagacaccttacgcgcc
atgaaccaacttggttatttatgcgaaccgcacggtgctgtagcttatgaagtgttaaaa
caagatttacaagcagacgaaaccggcttattcctgtgcaccgcgcatccggcaaaattt
aaagagtccgtcgaacgtattctggatttaactctgccattgccggaagccttggataaa
cacaataaactgctattattatctgatgaaatggaaaatgattttgcgcagttaaaagcc
tatttattgaaataa

DBGET integrated database retrieval system