KEGG   Aggregatibacter aphrophilus: NT05HA_0438Help
Entry
NT05HA_0438       CDS       T00929                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT05HA_0438
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT05HA_0438
  Amino acid metabolism
   00310 Lysine degradation
    NT05HA_0438
Enzymes [BR:aap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NT05HA_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447447..448652
Genome map
AA seq 401 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGIITEIL
QGEGATVVSKQLLGTLEDSVSAAAAAMEKTAEPTPADRRTEVPDEPHTSDVLSPGVRRLL
AELDVQATEVKGTGVGGRITREDVEAVIAKRAAAVKPAENTVSTVSYAARSEKRVPMTRL
RKRIAERLLEAKNNTAMLTTFNEVDMQPIMSLRKQYGEKFEKQHGVRLGFMSFYIKAVVE
ALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVTPVLRDCDKLSMAEIEKSIKALAE
KGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAIEGQVVI
RPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPTRLLLGI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattctcgtgccggatttgcccgagtcagttgccgatgccaccgttgcc
acttggcataaaaaagcaggggatgcggtgaaacgtgatgaagtgattgtggaaattgaa
accgacaaagtggtgcttgaagtgccggcacaagcggatggcattattaccgaaattttg
caaggtgagggtgctactgtcgtgagcaaacaattgctcggtacgttggaggattctgtt
tcagcagctgctgcagcaatggaaaaaacggcagaaccgaccccggcggatcgtcgtacc
gaagtgcctgatgaacctcatacctctgatgtgttaagcccgggagttcgccgtttattg
gcggaacttgatgtacaagccactgaggtgaaagggaccggcgtgggcggtcgtattacc
cgtgaagacgtcgaagcggttattgcaaaacgtgccgctgctgtgaaaccggcagaaaat
accgtcagcaccgtctcttatgccgcccgcagcgaaaaacgcgtgccgatgactcgtttg
cgtaaacgcattgcagaacgtttgttggaagccaaaaataacactgccatgttaaccaca
ttcaatgaagtggatatgcaaccgattatgagtttgcgtaaacaatatggtgaaaaattt
gaaaaacaacatggcgtacgtttgggttttatgtctttctacattaaagcggtggtggaa
gccttaaaacgttatccggaagtgaatgcctccattgacggtgatgacgtgatttatcac
aactattttgacgtaagtattgccgtttctacgcctcgcggtttggtgacgccggtattg
cgtgattgtgacaaactttctatggcggaaattgaaaaatctattaaggcgttggcagaa
aaaggccgtgatggcaaattgaccgtggaagatttaaccggcggtaactttacgatcact
aacggcggtgtgttcggttccttaatgtctacgccaatcatcaacccaccgcaaagtgcg
attttgggtatgcatgccattaaggatcgtccggtggctattgagggtcaagtggtgatt
cgtccaatgatgtacctggcgctaagttatgatcaccgtttaattgacgggcgggaatcc
gtcggtttcttagtgacggtaaaagagctgctggaagacccgacaagattattacttgga
atttaa

DBGET integrated database retrieval system