KEGG   Aggregatibacter aphrophilus: NT05HA_0438Help
Entry
NT05HA_0438       CDS       T00929                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT05HA_0438
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT05HA_0438
  Amino acid metabolism
   00310 Lysine degradation
    NT05HA_0438
Enzymes [BR:aap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NT05HA_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447447..448652
Genome map
AA seq 401 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGIITEIL
QGEGATVVSKQLLGTLEDSVSAAAAAMEKTAEPTPADRRTEVPDEPHTSDVLSPGVRRLL
AELDVQATEVKGTGVGGRITREDVEAVIAKRAAAVKPAENTVSTVSYAARSEKRVPMTRL
RKRIAERLLEAKNNTAMLTTFNEVDMQPIMSLRKQYGEKFEKQHGVRLGFMSFYIKAVVE
ALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVTPVLRDCDKLSMAEIEKSIKALAE
KGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAIEGQVVI
RPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPTRLLLGI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattctcgtgccggatttgcccgagtcagttgccgatgccaccgttgcc
acttggcataaaaaagcaggggatgcggtgaaacgtgatgaagtgattgtggaaattgaa
accgacaaagtggtgcttgaagtgccggcacaagcggatggcattattaccgaaattttg
caaggtgagggtgctactgtcgtgagcaaacaattgctcggtacgttggaggattctgtt
tcagcagctgctgcagcaatggaaaaaacggcagaaccgaccccggcggatcgtcgtacc
gaagtgcctgatgaacctcatacctctgatgtgttaagcccgggagttcgccgtttattg
gcggaacttgatgtacaagccactgaggtgaaagggaccggcgtgggcggtcgtattacc
cgtgaagacgtcgaagcggttattgcaaaacgtgccgctgctgtgaaaccggcagaaaat
accgtcagcaccgtctcttatgccgcccgcagcgaaaaacgcgtgccgatgactcgtttg
cgtaaacgcattgcagaacgtttgttggaagccaaaaataacactgccatgttaaccaca
ttcaatgaagtggatatgcaaccgattatgagtttgcgtaaacaatatggtgaaaaattt
gaaaaacaacatggcgtacgtttgggttttatgtctttctacattaaagcggtggtggaa
gccttaaaacgttatccggaagtgaatgcctccattgacggtgatgacgtgatttatcac
aactattttgacgtaagtattgccgtttctacgcctcgcggtttggtgacgccggtattg
cgtgattgtgacaaactttctatggcggaaattgaaaaatctattaaggcgttggcagaa
aaaggccgtgatggcaaattgaccgtggaagatttaaccggcggtaactttacgatcact
aacggcggtgtgttcggttccttaatgtctacgccaatcatcaacccaccgcaaagtgcg
attttgggtatgcatgccattaaggatcgtccggtggctattgagggtcaagtggtgatt
cgtccaatgatgtacctggcgctaagttatgatcaccgtttaattgacgggcgggaatcc
gtcggtttcttagtgacggtaaaagagctgctggaagacccgacaagattattacttgga
atttaa

DBGET integrated database retrieval system