KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0440Help
Entry
NT05HA_0440       CDS       T00929                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain (SCS-beta)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00020  Citrate cycle (TCA cycle)
aap00640  Propanoate metabolism
aap00660  C5-Branched dibasic acid metabolism
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01120  Microbial metabolism in diverse environments
aap01130  Biosynthesis of antibiotics
aap01200  Carbon metabolism
Module
aap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT05HA_0440
   00640 Propanoate metabolism
    NT05HA_0440
   00660 C5-Branched dibasic acid metabolism
    NT05HA_0440
Enzymes [BR:aap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NT05HA_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 PSI_PsaE
Motif
Other DBs
NCBI-ProteinID: ACS96859
Position
448839..450008
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQSKQVFTEYDLPICRGIACKTVDEAAEAIKQLKGGVWAAKCQVHAGGRGKVGGV
KLVSNEAEVRAFADKWLGQRLVTFQTDANGQPINIIYVEETVNIDRELYLGAVIDRASQK
VVFMASAAGGMDIEEMAVKTPELLHKVALDPLVGGMPYQGRELAFKLGLKGDQINQFTHI
FTQLAKMFVERDLSLLEINPLVVTKEGKLSCLDAKIVVDSNALYRQLDLATMHDITQSDA
REALAELHQLNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGQPANFLDVGGGTTKERVAE
AFKIILSDKNVKAVLVNIFGGIVRCDLIAEGIVAAVNQVGVHVPVVVRLEGNNAPLGREI
LANSGLNIIAAKTLTDAAVESVKAANGNL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacacgaataccaaagtaagcaggtttttaccgaatatgatttaccgatatgc
cgaggcatcgcctgtaaaaccgtagacgaagcggcggaggcgatcaaacagctgaaaggc
ggtgtttgggctgctaagtgccaagtgcatgcaggcggacgcggaaaagtcggtggtgtg
aaattggtgagtaatgaagcggaagtgcgcgcctttgcggataaatggctggggcagcgt
ttggtgacctttcaaaccgatgccaatggacaaccgattaatattatttatgtggaagaa
acagtcaatatcgaccgagagttgtatttgggcgcggtgatcgatcgtgcttcacaaaaa
gtggtttttatggcatctgctgccggcggtatggatattgaagagatggcggtgaaaacc
ccagaattattgcacaaagtggcgttggatccgctggtgggtggaatgccttatcaaggg
cgtgaattggcgtttaagctggggttaaagggcgatcaaatcaaccaatttacccatatt
ttcacccaactggcgaaaatgtttgtagagcgggatttatctctgttggaaattaatccg
cttgtggtaaccaaagaaggcaagctgtcttgtctggatgccaagatcgtggtggacagt
aatgcgctgtatcgccagctggatttagccactatgcacgatattacccaaagcgatgcg
cgtgaagccttggcggaattgcaccagctgaattacgtagctctagacggcaacatcggc
tgtatggtcaatggcgccgggcttgccatgggcacgatggatattgtgaaactgcacggc
gggcagcctgcaaatttccttgatgtgggcggtggcacaaccaaagaacgggtggcggaa
gccttcaaaatcattctttccgataaaaacgtcaaagccgtattggtgaatattttcggc
ggcattgtgcgttgcgatctgatcgccgaaggcattgtggcggcagtcaatcaagtgggc
gtgcatgtgcctgtggtagtgcgtttggagggcaacaatgcgcctttaggacgggaaatt
ttagccaacagcggtttgaatattattgcagcgaaaaccctcacggacgcggcggtggaa
tccgttaaagcggcaaatggtaatctataa

DBGET integrated database retrieval system