KEGG   Aggregatibacter aphrophilus: NT05HA_0490Help
Entry
NT05HA_0490       CDS       T00929                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
aap  Aggregatibacter aphrophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488577..489104
Genome map
AA seq 175 aa AA seqDB search
MLAKCSVVVIAGIILANYPDEIRTGEVGLLVIGNAEDCYREPYKCPADVWTDGIGNTNDV
VLGRKLSDEEIAERWKDNIKIAENCVNRWANGKELSQGAFEAAVSITFNVGCSKLKQATL
FKYARVGDINLMCNQFPRWVYSQGKVLPGLVKRRNVEKALCLGLIKSPEQLSAYR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttagctaaatgcagtgttgttgtcatcgctggaattatcctcgccaactatccggac
gaaatccgcactggtgaagttgggttgctggttatcggtaatgcagaagattgttaccgc
gagccgtacaaatgtcctgctgacgtatggaccgacggaatcggcaatacaaacgacgta
gtgttagggcgtaagctatcagacgaagaaatagcggagcgttggaaagataacatcaag
attgccgagaactgcgttaatcgttgggcaaacggcaaagagttatcgcaaggcgcattt
gaagcggcggtatcaatcacgttcaatgtcggttgctcgaagttaaaacaagccacgtta
tttaaatacgcccgcgtaggtgatattaatttaatgtgtaatcaattcccccgctgggtg
tactcgcagggcaaagtcctgccgggtttagtcaagcgtcgtaacgtggagaaagcctta
tgtttgggattaataaaatcaccggaacaattatcggcgtatcggtga

DBGET integrated database retrieval system