KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0657Help
Entry
NT05HA_0657       CDS       T00929                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00010  Glycolysis / Gluconeogenesis
aap00020  Citrate cycle (TCA cycle)
aap00620  Pyruvate metabolism
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01120  Microbial metabolism in diverse environments
aap01130  Biosynthesis of antibiotics
aap01200  Carbon metabolism
Module
aap_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT05HA_0657
   00020 Citrate cycle (TCA cycle)
    NT05HA_0657
   00620 Pyruvate metabolism
    NT05HA_0657
Enzymes [BR:aap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NT05HA_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ACS97058
Position
660333..662213
Genome map
AA seq 626 aa AA seqDB search
MAKQIQIPDIGSDEVTVTEVMVKVGETITADQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVTTGTPMLVLDSADAAPARAPAAAPAPTAAPASAQVIDVNVPDIGGDEVNVTDVMV
KVSDRVEVDQSIINVEGDKASMEVPAPVAGIVKEIIIKAGDKVSTGTLIMRFEVAGSAPT
AVPTASAPVAAPAAPVAGGVKDVNIPDIGGDEVNVTEIMVKVGDTITEEQSLITVEGDKA
SMEVPAPFAGVVKEILVKSGDKVSTGTLIMRFEVAGSAPVAAPAPQAAAPAPTAAPAVAP
SAPAATTSDADVTGAKSYAHATPVIRRLAREFGVNLDKVKGTGRKGRILKEDVQAYVKTA
VKALESGAASATGAANGAGLGLLPWPKVDFSKFGEIEEVELSRINKISGANLHRNWVMIP
HVTHFDKADITDLETFRKEQNALAEKQKLGVKITPVVFIMKAVAKALEAFPRFNSSITED
AQRLILKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELADVSKKARDGKLTASDMQ
GGCFTISSIGGLGTTHFAPIVNVPEVAILGVSKSSMEPVWNGKDFAPRLILPISLSFDHR
VIDGADGARFISYIGSVLADLRRLVM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaattcaaattccggatattggtagtgatgaagttaccgtaaccgaagtc
atggtgaaagttggagaaactattactgcggatcaatccatcattaacgtagaaggcgac
aaggcttccatggaagttccggcacctgaagcgggcgtggtaaaagaaattttagtgaaa
gtaggcgataaagtcactaccggtacaccgatgctcgtgttagacagcgctgatgctgca
ccggctcgagcgcctgcagctgctcctgcgccaaccgcagcacctgctagcgcccaagtt
attgatgtcaacgtaccggatatcggtggtgacgaagtcaatgttactgatgttatggta
aaagttagcgaccgcgttgaagttgatcaatccatcattaacgtagaaggcgacaaagcc
tctatggaagtacctgctcctgttgcaggtatcgtaaaagaaattatcatcaaagccggc
gataaagtttccacaggtacattaatcatgcgctttgaagttgccggtagcgcaccgact
gccgtacctactgcatcagcaccggtagctgcaccggccgctccggtcgcaggtggcgtg
aaagatgtgaatatcccggacatcggcggcgatgaggtgaatgtcaccgaaatcatggtg
aaagttggtgataccattactgaagagcaatccttaattaccgtagaaggcgacaaagct
tctatggaagtgcctgctccgtttgccggtgtggtgaaagaaattttagtaaaatccggt
gataaggtttcaaccggtacattaattatgcgctttgaagttgccggtagtgcaccggtt
gccgcaccggcaccacaagccgctgcacctgcaccgacagctgcgccggccgtagcacct
tctgcaccggcagcaaccacttccgatgccgatgttaccggtgcgaaaagctacgctcat
gcaacaccggttattcgtcgtcttgcccgcgagtttggcgtaaatcttgataaagtgaaa
ggtaccggtcgtaaaggtcgtatcttaaaagaagacgttcaagcttatgtgaaaactgcc
gtgaaagcgttagaaagcggtgcggcttctgctacaggcgctgcgaatggcgcaggctta
ggcttattaccatggccaaaagtggacttcagcaagtttggtgaaattgaggaagttgaa
ttaagtcgtattaacaaaatctccggtgcgaacttacatcgtaactgggtcatgattcct
catgttacccacttcgacaaagcggacatcacagatttagaaaccttccgtaaagaacaa
aatgctttagctgaaaaacaaaaacttggtgtgaaaatcacgccggttgtattcattatg
aaagccgtcgctaaagcgttagaagcgttcccacgtttcaacagttcaattaccgaagat
gcacaacgcttaatcttgaaaaaatatatcaatatcggcgttgcggtggatacaccaaac
ggtttggttgttcctgtatttaaagatgtaaacaaaaaaggtattatcgagctttcccgt
gaattggcagacgtttctaagaaagcccgcgacggtaaattaacggcatccgatatgcaa
ggcggttgtttcaccatctccagtatcggtggtttgggcacaactcactttgcaccaatc
gtgaatgtccctgaagtggcgattttaggtgtatccaaatcttcaatggaacctgtatgg
aacggtaaagatttcgcaccgcgcttaattcttccgatttccttgtcattcgaccaccga
gtcattgacggtgcggatggcgcgcgtttcattagctacatcggttccgtattggctgat
ttacgtcgtttagttatgtaa

DBGET integrated database retrieval system