KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0811Help
Entry
NT05HA_0811       CDS       T00929                                 

Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01130  Biosynthesis of antibiotics
aap01230  Biosynthesis of amino acids
Module
aap_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NT05HA_0811
Enzymes [BR:aap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NT05HA_0811
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NT05HA_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI HHH_4 QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACS97200
Position
823194..824624
Genome map
AA seq 476 aa AA seqDB search
MITQDFSKPLETATVLQKIVLDKAEWVKNKEAEFPLSEFEKNIQKSDRSFYDTLAKGTHP
KPGYILECKKASPSKGLIRSEFKPTEIAQVYKHYANAISVLTDEKYFQGDFSYIKQVRDV
VTQPVLCKDFMISEYQVYLARFYQADAILLMLSVVNDETYRILADLAHSLGMGVLTETSN
EEEFERALALGAKIIGVNNRNLHDLSVDLNRVVALTNRYADRIPSDVRIISESGIYHHQQ
VRELQQVAHGFLIGSSLMGNPDLNNAVREVIFGENKVCGLTRAQDVKTVYESGALYGGLI
FVENSKRCVSLRQAQELVTAAPLRFVGVFQNQGIDFIVKIAQQLQLYAVQLHGDETPEFI
TALRTELPKSIRIWKAISVDVNHKSAVVFDDVYAIDRFVFDSKSGAQQGGTSETFDWSLI
PAHLKHKILLAGGINPNNIDAALAQHCIGVDLNSGVESAPGVKDAEKVRSVFSKIL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatcacacaagacttttccaaaccacttgaaactgctacggtattacaaaaaatcgtg
ctcgacaaagccgaatgggtaaaaaacaaagaagcggaatttccattaagtgaatttgaa
aaaaacattcaaaaatccgaccgctctttttatgatacgttagcaaaaggcacgcaccca
aaaccggggtacattttggaatgtaaaaaagcctcgccgtccaaagggttgattcgcagt
gaatttaaaccaacagagattgcacaggtttataaacactatgctaatgcgatttctgtg
ctgaccgatgaaaaatacttccaaggcgatttttcttacatcaaacaagttcgcgacgtt
gtcacacaaccagtattgtgcaaagactttatgatcagcgaatatcaggtgtatttggcg
cgtttttatcaagccgacgcgattttactcatgctttctgtggtgaacgatgagacttat
cgcatcttggcggatttggcacattctctcggcatgggcgtgttaaccgaaaccagcaac
gaagaagaatttgaacgcgccttggcgttaggggcaaaaattatcggtgtgaataatcgt
aatttgcatgatttaagcgtggatttaaaccgcgtggtggcattaaccaaccgatatgcc
gaccgcattccttccgacgtacgaatcatcagcgaatcaggcatttaccatcatcaacaa
gtacgtgaattgcaacaagttgctcacggtttcttaatcggcagcagtttaatgggcaac
cctgatttgaacaacgccgtgcgtgaagtcattttcggcgaaaacaaagtgtgcggttta
acccgtgcgcaagacgtaaaaaccgtttacgaaagcggcgcattgtacggcgggctgatt
tttgtcgaaaattccaaacgttgtgtcagtttacgccaagcccaagaattggtgacggcc
gcaccacttcgttttgtgggcgtgtttcaaaatcaaggcattgattttatcgtgaaaata
gcgcagcaattacagctctatgccgttcagttgcacggcgatgaaacgccggaatttatc
accgcacttcgaaccgaattgcctaaaagcattcgcatttggaaagccatttccgtggat
gtaaaccataaaagtgcggtcgtttttgacgacgtttatgcgattgatcgttttgttttc
gatagcaagtcaggcgcacaacaaggcggtacgagtgagactttcgattggtcgctgatt
cctgcccatctgaaacataaaatccttttagccggaggcatcaatccaaacaatattgac
gcggcattagcacaacattgtatcggtgttgatctgaattccggcgtggaaagtgctcca
ggtgtgaaagacgcggaaaaagtgcggtcggttttttcaaagattttgtaa

DBGET integrated database retrieval system