KEGG   Aggregatibacter aphrophilus: NT05HA_0825Help
Entry
NT05HA_0825       CDS       T00929                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT05HA_0825
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT05HA_0825
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NT05HA_0825
Enzymes [BR:aap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NT05HA_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
837556..838755
Genome map
AA seq 399 aa AA seqDB search
MSETILNPYFGEFGGMYVPEILVPVLQELEKAFVEAKDDPEFQREFQDLLKNYAGRPTAL
TLCRNLTKGTKAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLGMPCRIYMGAKDVERQSPNVFRMRLMGAEVVPVQKGSCSLKDACCEAMRDWSA
NYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEKEGRLPDAVIAAVGGGSNAIG
MFTDFIDEPNVRLIGVEPAGHGIESGEHGAPLGHAKVGIYFGMKSPLMQTEDGQVEESYS
ISAGLDFPSVGPQHAYLQSIGRAEYPSITDDEALNAFQALAKHEGIIPALESSHALAQAL
KMIHQEPNKEQILVVNLSGRGDKDIFTVDKILNEKGMQL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagacaattttaaacccttatttcggtgagtttggcggtatgtatgtgccggag
attctcgtaccggtgctacaagaattagaaaaagcgtttgttgaagctaaagatgatccg
gaattccaacgtgaatttcaggatttattgaaaaattatgccggcagaccgaccgcactt
accctttgccgtaatttaaccaaaggcacaaaagcgaaaatttatttaaaacgtgaagat
ttgcttcacggtggcgcccataaaaccaaccaagtattaggtcaaattttgctggctaaa
cgcatgggaaaaacgcgtattattgcagaaaccggtgccggtcaacacggtgtggcgaca
gcccttgcctgtgcgatgttggggatgccttgtcgtatttatatgggcgcgaaagacgta
gaacgtcaatctccaaacgtattccgtatgcgtttaatgggcgctgaagtggttcctgtg
caaaaaggctcctgttccttaaaagatgcctgctgtgaagccatgcgtgattggtcggca
aattatgaaaacacccattatctgctaggtacggcggcaggccctcacccattcccaacc
attgtgcgtgaattccaaaaaatgattggcgaagaaaccaaacgtcaaatcttagaaaaa
gaaggtcgtttaccggatgccgtgattgcagcggtaggtggcggctcaaacgctatcggt
atgtttacggatttcattgatgaaccgaatgtgcgtctaattggcgtagaacctgccggt
cacggcattgaaagcggtgaacacggcgcgccgttaggccatgcgaaagtggggatttat
ttcggcatgaagtcgccgttaatgcaaacggaagacggccaagtggaagaatcctactcg
atttctgcgggattggacttcccttctgtcggcccgcaacacgcctatttgcaaagcatt
gggcgcgcggaatacccaagcattaccgatgacgaagccctaaatgcgttccaagcactg
gcaaaacatgaaggcattattcctgcattagaaagctctcacgcgttggcgcaggcgtta
aaaatgattcatcaggagccgaataaagaacaaattttggtggtgaatttatccggtcgt
ggtgataaagacattttcaccgtagataaaattttaaacgaaaaaggaatgcaattatga

DBGET integrated database retrieval system