KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0826Help
Entry
NT05HA_0826       CDS       T00929                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00260  Glycine, serine and threonine metabolism
aap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01130  Biosynthesis of antibiotics
aap01230  Biosynthesis of amino acids
Module
aap_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT05HA_0826
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NT05HA_0826
Enzymes [BR:aap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NT05HA_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACS97215
Position
838752..839558
Genome map
AA seq 268 aa AA seqDB search
MSRFETTFAQLSAKNEGAFVPFVTLCDPTFERSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALNAGHSTEDSFKLLAKVRSKYPEIPISLLLCANLIFAKGLDNFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGVQPVFICPPNADAKTVQGVAENSEGYTYLVSRA
GVTSAENQSHAANLDTLVEQLKAHHAPPILQGFGIAQPLQVKEALQLGAAGAISGSATVK
IIERNLDNHAQCLSELGEFVRNMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaaccacatttgcccaattaagcgcgaaaaatgaaggcgcattcgtt
cctttcgttaccttatgcgacccgacctttgagcgttcttttgagattatttgtaccctc
gtcgataacggcgcggacgcattggaattgggctttccgttttctgatccgttattagac
ggtcctgttattcaggcagccaataatcgtgcgctcaacgccgggcatagcacggaagac
agctttaaattgcttgccaaagtgcggtcaaaatacccggagattcccattagtctgttg
ctttgcgctaatttaatttttgccaaaggcttggataatttttatcaacgttgtgcggaa
gtcggtgtggatgccgttttagtggcggatattccattattggcaaaagaagactatgtc
caagcagccaaaaaacacggtgttcaacctgtctttatttgccccccgaatgcggatgcc
aaaacggtgcaaggtgtggctgaaaatagcgagggctatacttatttggtttctcgtgcg
ggcgttaccagcgcagaaaatcaaagtcatgcggctaacttagatacccttgtagagcaa
ctcaaagctcaccatgccccgcctatcctacaaggtttcggcattgcccaaccgttgcaa
gtaaaagaagcgcttcaactcggtgcagccggcgcgatttccggttcggcgacagtaaaa
attattgagcgaaacttagataatcacgctcagtgtctgagcgaacttggcgagtttgtt
cgcaatatgaaagcggcgacaaaataa

DBGET integrated database retrieval system