KEGG   Aggregatibacter aphrophilus: NT05HA_0866Help
Entry
NT05HA_0866       CDS       T00929                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aap03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(879885..881864)
Genome map
AA seq 659 aa AA seqDB search
MLALLSQLKEKGIINAADYYFAEFIHRKQQPFQYASSIQNLAVLMAALCNFSYRQGNTCI
LLNQSTEQDLFGLQDYFNERVYLTEIQQKIDYVPIAQWQTKLLDAQHIAFSAEPLKQIAP
LVLQFDRLYFYRIWQDEFRIADYFKSAVRFQHVFLAEQIAQIAPILNRYFHEEQGIDWQK
IAVAMALRQRFCLITGGPGTGKTTTVTKLLLTLQELHQNSLRIKLVAPTGKAAARLTESI
VDAVGRLKQTFSTEKHEREIIENLRIPMNAETLHRLLGVRFFSEETRYYADNPLPVDMLV
VDEASMIDLTLMAKLLNALKPETKLILLGDKDQLASVEAGAILGELGRFVNASAPTYSLA
MAQYLQETTGISLAASERGNPISDSICYLQVSRRFGANPEVGALAAAVNSGNAAESWQLL
QQYQQHQAKKCGVYLTDFARYLTNKEDSQQRKTCVKLIVERAAEEYRRYLQLISQEGQMD
EEKVRSIFAAFNGIRFLAALRVGEFGVEQLNLAIAEKLRQKRLLQFHQEREWYIGKPIMV
TQNDGNVGLYNGDIGMYLGNGRVWFEQGQNSYKTVLASRVPNHETAFVMTVHKSQGSEFP
HTFLILPLENSPVLSKELVYTGVTRTKDFLTVFALQSVWESAVKNPVQRQSGLGQLLEI
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgttagctctattatcccaactcaaagaaaaaggcattatcaacgccgccgactattat
tttgccgagtttattcaccgcaaacagcaaccttttcaatatgcttcttccattcagaat
ctggcggtattgatggcggcgttgtgcaatttcagttatcgccaaggcaacacctgtatt
ttgctgaatcaatctacggaacaagatttattcggcttgcaggattatttcaacgagcgt
gtttacttaacggaaattcagcaaaaaattgattatgtgcccattgcgcagtggcagacg
aaattgctagacgcccaacacattgcctttagtgccgaaccgttaaaacaaattgcgccg
ttggtgttgcagtttgatcgcttgtatttttatcgcatctggcaggatgaattccgtatc
gctgattactttaaaagtgcggttcgttttcaacatgtttttttagctgaacagatagcg
caaatcgccccgattttgaaccgctattttcatgaagaacagggcatcgactggcaaaaa
attgcggtggcgatggcgttacgtcaacgattttgcctcatcaccggcgggccaggcacg
ggcaaaaccactaccgtcaccaaactgttattgaccttgcaagagcttcatcaaaacagc
ttgcgcattaaacttgtcgctccgactgggaaagcggcggcacggcttacggaatccatt
gtggacgcggtaggtcgcctgaaacaaactttttcgacggagaaacacgaacgggaaatc
atcgaaaatctgcgtattcccatgaacgcggaaacccttcatcgcttgcttggcgtgcgt
tttttcagtgaagaaacccgctattatgccgacaatcctttgccggtggatatgttggtg
gtggacgaagcgtctatgatcgatttaaccttgatggcgaagctgctcaatgcccttaaa
ccggaaaccaaattgattttattgggtgataaagatcaactggcttctgtagaagccggg
gcgattttgggcgaattagggcgtttcgtgaatgcgtcggcgccgacgtatagcctcgca
atggcacaatatttacaggagacaacgggcatttctcttgctgcgtcggaacgtggtaat
cctatcagcgacagcatttgttatttgcaggtcagccgccgtttcggggcaaatccggaa
gtgggtgcgttggcggctgcggtgaattcaggcaacgcggcggaaagctggcagttattg
cagcaatatcagcaacatcaagcaaaaaaatgcggcgtatatttaactgattttgctcgt
tatttgaccaacaaagaagatagtcagcaacgtaaaacctgtgtgaagctcatcgtggaa
cgtgcggcagaggaatatcgtcgttatttgcagttgatttcacaagaagggcagatggat
gaagaaaaagtgcggtcgattttcgcggcgtttaacggcattcgttttttagcggcgttg
cgtgtgggcgaattcggcgtggagcaattaaatctcgccatcgcagaaaagttgcgccaa
aaacgcctgttacaatttcatcaggaacgggaatggtacatcggcaaaccgattatggtg
acgcaaaatgatggcaatgtgggcttgtataacggtgacatcggcatgtatttgggaaac
ggacgggtatggttcgagcagggacaaaatagttataaaaccgtgctggcaagtcgtgtg
ccgaatcatgaaaccgcattcgtaatgacggtacacaaatcacaaggttcggaattcccg
catacttttctgattttgccgctggaaaacagccccgtgttatccaaagaactagtttac
accggcgttacccgcaccaaagattttttaacggtgttcgcgctacaaagcgtatgggaa
agcgcggtgaaaaatccagtgcaacggcaaagcggattaggtcaattactggaaatataa

DBGET integrated database retrieval system