KEGG   Aggregatibacter aphrophilus: NT05HA_0942Help
Entry
NT05HA_0942       CDS       T00929                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT05HA_0942 (malQ)
Enzymes [BR:aap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NT05HA_0942 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
959911..961986
Genome map
AA seq 691 aa AA seqDB search
MSIKEKSFDQAGIMPYFFDERSSKIRAPLHIKQALLATFDGHLRSRTNPLPPVKILYQNQ
PHFLPLTTSDKKHPWLGKWQLRLENSGEILEGRVKKNHIELPRDLPLGYHDLTLFGHKKT
VECRIIVAPQRCYQPQELKQGKKLWGSFIQLYTLKSAQNWGVGDFGDLKQFLQELAPYQA
DFLGLNPIHALFPANPDGASPYSPSSRKWLNVIYIDVNQLPEFQQSKSAQKWFASAEVQQ
KLSDLRAAEWVNYGKVLPLKLKGLRFAFDEFKQNSTALSQQAFADFVRDGGESLQVQATF
DALHAHLSSRYAAQWGWDFWAPQFRDYHSETVAQFRHQYGEEIEFYAWLQFCADRQLAEC
DALCKTQQMTIGMYRDLAVGVTGSGSETWNDKELYCLRASVGAPPDILGPQGQNWGLTPM
NPHILKQRAYQPFIDLIRANMKHCGALRIDHIMSLLRLWWIPKGDCPANGAYVRYPVDDL
IAILALESQRHRCLIIGEDLGTVPKEIVSKLKNAGILSYKIFYFEFDQQGQSRHLQEYPY
QAMTTLSTHDLPTINGYWRGYDFELGQKYGVYPNPKILQILRHSRIDAKEKILARLSEND
VKVDKGIDETLSSAVTKKFTHQLQTYVADVSSALFGFQPEDWLDMTEPVNIPGTSMEYAN
WRRRLTQNIDAIFADKDIQTLLKEVKAKRKG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaaagaaaaatccttcgaccaagcaggcatcatgccttatttttttgatgag
cgcagttcaaaaatacgtgcaccgttacacatcaagcaagccttgttggcaacctttgac
ggtcacctccgcagccgcactaacccattgccgccggtgaaaattctctatcaaaatcaa
ccgcactttttgccgttaacgacctccgataaaaaacatccatggttagggaaatggcaa
ctgcgtttggaaaattccggagagattcttgaaggtagagtgaagaaaaatcatattgaa
ctgccacgggatttaccgctcggctatcatgatttaactcttttcggtcataaaaaaacc
gtggaatgtcgcattattgtggctccacaacgttgttatcagccacaagaattaaaacaa
ggcaaaaagttgtggggttcctttattcagctttacaccttgaaatcggcgcaaaactgg
ggcgtgggtgattttggtgatctcaaacaatttctacaggaattagcgccttatcaagcg
gattttttaggtctaaatccaattcatgcgctcttcccggcaaaccctgacggtgccagt
ccatacagcccctcttcgcgcaaatggctgaatgtgatttacattgatgtgaatcaactg
cccgaattccaacaaagcaaaagtgcacaaaaatggtttgcttccgcggaagtgcaacaa
aaattaagtgatttgcgtgccgccgaatgggtgaattatggaaaagtgcttccgttaaaa
ctgaaaggattgcgttttgcgtttgacgaatttaagcaaaattcgaccgcactttcacaa
caagcctttgccgatttcgtacgcgacggtggtgaaagtttacaggtgcaagccaccttc
gatgcattacacgcccatttaagtagccgttatgcggcacaatggggttgggatttttgg
gcaccacaattccgtgactaccattccgaaacggtcgcccaattccgccatcaatatggc
gaagaaatcgaattctacgcgtggttgcaattctgtgccgaccgacaacttgccgaatgc
gatgccttatgcaaaacacagcaaatgacaattggtatgtatcgtgatttagcggttggg
gttaccggtagcggttcggaaacctggaatgataaagaactgtattgtctgcgcgcttct
gtgggtgcgccaccggatattctcggtccgcaaggtcaaaattggggcttaaccccgatg
aatccccatatactgaaacagcgcgcataccaaccgttcattgatttgattcgtgccaac
atgaaacactgtggtgcattacgtatcgatcatataatgtcgttgttgcgtctctggtgg
attccaaaaggcgattgcccggcaaacggcgcttatgtgcgttatccggtggatgattta
attgcgattttggctttggaaagtcaacgtcaccgctgtttgattatcggtgaagattta
ggcacggtaccaaaagaaatcgtcagcaaactcaaaaatgcaggcattttgtcttataaa
attttctactttgaatttgatcaacaaggacaaagtcgccatctgcaagaatacccgtat
caggcgatgaccacattaagcacccatgatttaccaaccattaacggttattggcgcggt
tatgattttgaattgggacaaaaatacggcgtgtatccgaatccgaaaatcttgcaaata
ttgcgacatagcagaattgatgccaaagaaaaaatcttggcacgccttagcgaaaacgac
gttaaagtggataaaggcattgatgaaaccttgtcttccgccgttacgaaaaaatttacc
catcaattgcaaacttatgtcgctgatgtcagcagcgccctctttggtttccaaccggaa
gactggctggatatgaccgagccggtcaacattccgggtaccagtatggaatacgctaac
tggcgccgccgtttaacgcaaaatatcgatgccatttttgccgataaagacattcaaacg
ttgttgaaagaagtgaaagcgaaacgtaaagggtaa

DBGET integrated database retrieval system