KEGG   Aggregatibacter aphrophilus: NT05HA_0966Help
Entry
NT05HA_0966       CDS       T00929                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aap00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aap00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
989407..992445
Genome map
AA seq 1012 aa AA seqDB search
MLLANYYQDPTITQIHALPHHSYFIPFAKKDKVDQFARENSSFFTSLNGQWQFAYYSSMQ
DLPEKISEIPFVEQIHVPSNWQNHGFDTHQYTNINYPFPFDPPFVPLENPCGVYQKQVQL
NKNPNKRYLLNFEGVDSCLYVYVNQEFVGYGSISHSTNEFDITDYLHHGENSLTVFVLKW
CAGSYLEDQDKFRMSGIFRDVYLLEREHNYLQDLHIKTVLSEDLSVGQIYLDLKFAKCAD
DIRVTLFDTTDQIVQTECKITMNEQRTQIHLDNIPLTKSQLWNAENPALYTLVFHTEDET
ITQKVGFRKVEIKNGVLLLNQQPIKFKGVNRHDSDPKTGYAISVAQAMTDLTLMKQHNIN
AIRTAHYPNSPWFCELCDRYGFYVISESDIESHGASFQAISQPEPSIFLNVENANEEQRI
RQQMIDNFCYFAQEPLYQTALLERTKANVERDKNRSSILIWSLGNESGYGKNFEYCAQWV
KERDPDRLVHYESSIYQHSAHKNNTEHLDLYSEMYSDTEVIDAYFSDVSQTKKPFLLCEY
SHAMGNSNGDMEDYFQTFNKYSGSCGGFIWEWCDHAPFITPTKLGYGGDFGEKIHDGNFC
VDGLVSPERIPHSNLLEVKNVNRPVRAILNNDQVEVHNYFDFTNLKDSIQIKYEWVKNGQ
VTETGTLAVDCEPHCSQLLPIQLPKERGGLLWLNLFYCSTKQTDLLQAEHCFGFDQIILS
KEYTPAITLDNGYQQPLEITETKSQIIIRNSQYYYEFNKITGVIKEIKVNGNDIIYKPLA
WNIWRAPTDNDRLIRSQWQNAGYDQMYSKVYDICAHLQENSVVVSVKSALVANAKSKIMT
LETQYLLSENGKLDIKTDAIFHEHLPFLPRFGLRFFLDKQKTPFTYLGYGAGESYIDKHQ
ASQFGIYLTIAEKNHVNYLKPQENGSHYGCFYVKNDLIKIESEQPFSFNLSPYTQEELTQ
KTHSYELVRAGYDVLCIDYKMSGIGSNSCGPNLKSKYRLIENNINFNISIRL
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgttattagcaaattattatcaagatcctacaattacacaaattcatgcattaccgcat
catagctattttattccttttgctaaaaaggataaggtagatcaatttgctagagaaaac
tcttcatttttcacatcattgaatggtcaatggcaatttgcttattattcaagtatgcaa
gatttgcctgaaaagataagcgaaattccgtttgtagagcaaatccacgtgccttcaaat
tggcagaatcacggatttgatacccatcaatataccaatattaattatccttttccgttt
gatccgccttttgtaccgttagagaacccttgcggggtatatcaaaagcaagtgcagctg
aataaaaatccgaataaacgttatttactgaattttgaaggggttgattcttgtctttat
gtgtatgtaaatcaagagtttgtaggatatggttcgattagccatagtaccaatgaattt
gatattactgattatcttcatcatggtgaaaatagcttaaccgtctttgttctaaaatgg
tgtgcgggcagttatctagaagatcaggataaattcagaatgtcgggaatttttcgagat
gtctatttattggaaagggaacataattatctgcaagatttgcatattaaaacggtactt
tcagaagatttatccgtaggacaaatctatctcgacctaaaattcgcaaaatgtgcggat
gacattagagtgacattgtttgatacaacggatcaaattgttcagacagaatgcaaaatt
acaatgaatgaacaacggacacaaatccaccttgataatattcctttaaccaaatcacaa
ctgtggaatgcggaaaacccagcgctttatactttagtattccacacggaagacgaaact
attacgcaaaaagtggggttccgcaaggtagaaattaaaaatggcgtattgctgctgaat
cagcaacctattaaatttaaaggtgtaaaccgccacgacagtgatccgaaaaccggatat
gctatttcagtcgctcaagcgatgactgatttaacgttaatgaagcaacataatattaat
gccattcgtaccgcacactatccaaattcaccgtggttttgtgagctttgcgatcgctat
ggtttttatgtaattagtgaaagtgatattgaaagtcatggcgcatcattccaagctatt
tcacagccggaaccaagtatctttttgaatgtagaaaacgctaatgaagaacaacgcatt
cgccagcaaatgatagataacttttgctattttgctcaagaacctttgtatcaaacagca
ttattagagcgaactaaagccaatgtggaacgcgacaagaatcgcagttcgattttgatt
tggtctttaggcaatgaatcggggtatggcaagaattttgagtattgcgcacaatgggta
aaagaacgggatccggatcgtttagtgcattatgaaagtagtatttaccaacattcggca
cataaaaataatactgagcatttagatttatacagtgaaatgtactctgatacagaggtg
attgatgcctatttttccgatgtatcacaaacgaagaaaccattcttattgtgcgaatat
tctcacgcgatgggaaattcaaatggtgatatggaagactattttcaaacatttaataaa
tattcaggaagttgtggaggatttatttgggaatggtgtgaccatgcgccatttattacc
ccaacaaaactaggatatggcggtgatttcggcgaaaaaatccatgatggaaatttctgt
gtggatggtttggtttcacctgaacgtattccgcacagtaatttattagaagtgaaaaat
gtcaatcggcctgtacgagcaatcttaaataatgatcaggttgaagtacataactatttt
gacttcactaatttaaaagatagtattcaaattaaatatgaatgggtaaaaaatggtcag
gtaactgaaacaggaacattagcggttgattgtgaacctcattgttctcaacttttacca
attcaacttcccaaagaacgaggcggattgttatggttaaacctattttattgttctact
aaacagactgacttattacaagctgaacactgttttggttttgatcaaattatcctaagt
aaagagtatacgcctgctattacattagataacggctatcagcaaccgctagaaatcact
gaaacaaaaagccaaattattattcgaaatagccaatactattatgaatttaataaaatc
acaggggtaatcaaggaaatcaaagtcaatggtaacgacattatctataagccattagct
tggaatatttggcgggctccaacagataatgatcgcctgattcgttctcaatggcaaaac
gccggttatgatcaaatgtattctaaagtctatgatatttgcgcacatctgcaagaaaat
agcgttgtggtgtcagtgaaaagtgcattagtagcgaatgcaaaatcaaaaatcatgaca
ttagaaacacagtatttgttatctgaaaatggtaagttagatatcaaaacagatgcaatt
ttccatgagcatttaccatttttgcctcgttttgggttacgtttcttcttggataaacag
aaaacgccttttacctatttaggatatggggcaggagaaagttatattgataagcatcaa
gcaagtcaatttggaatttatttaacaatagcagagaaaaaccatgttaattatcttaaa
cctcaagaaaatggtagccattatgggtgtttttacgttaaaaatgatctgattaagatt
gaatcggaacagccatttagttttaatttatcaccttatacccaagaagaattgacacag
aaaacgcattcttatgaattggttcgcgcggggtatgatgtattgtgtatcgattataaa
atgagtggtattggttcaaattcttgcgggcctaatttgaagtcaaaatatcgcctaata
gaaaataatattaattttaatataagtatccggttataa

DBGET integrated database retrieval system