KEGG   Aggregatibacter aphrophilus: NT05HA_1056Help
Entry
NT05HA_1056       CDS       T00929                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aap  Aggregatibacter aphrophilus
Brite
Enzymes [BR:aap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NT05HA_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1066987..1068372
Genome map
AA seq 461 aa AA seqDB search
MKKFALKSAVIAIAGYLGVVGYVHHYDNGQMEKLLAEGNYSAEQQKIAKVFFNNGCQYCH
TPSAELPFYARVPLVDSIMQNDIKGGNRVFLLNKLLEGLKNPSKLSEVDLAKLERVIEND
EMPIAKFRHIHWGSRPDEDEKTTLLNWIREQRKAFLPANTEGTDNNRLVQPIPDEIMTDA
AKVALGHKLFMDGRLSGDGTIQCHTCHQLSKGGVDRLDVSTGIDGKKGGINAPTVFNAAF
NFVQFWDGRAVDLADQAGGPPLNPVEMGSQSWEEIVAKFEQDEAFKQEFLQVYPQISKET
ITNAIGEYEKTLITPNSDFDRYLKGDKTALNAQQLKGYELFKQHKCDTCHTGVNMGGQSY
EYMGIYGDYFKDRGTPITEADQGRFAQTQDPYDMHRFKVPSLRNIALTAPYMHDASAKDL
KEAVRIMLKYQSNAKPQQQDIDDITSFLESLNGEFEGKKLQ
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgcattgaaaagcgcagtcatcgcgattgccggttatcttggggttgtt
ggatatgttcatcactatgacaacggacaaatggagaaattacttgccgaaggtaattac
tctgctgaacaacaaaaaattgccaaagtcttttttaacaatgggtgtcaatattgtcac
acaccaagtgccgagttgccattttatgctcgtgttccgctagttgattctataatgcaa
aacgacattaaaggaggcaaccgcgtatttctattgaataaattgctcgaaggcttaaaa
aatccaagtaaattatcggaagtggatttggcaaaacttgagcgcgtcattgaaaatgac
gaaatgccgatcgcaaaattccgtcatattcactggggaagtcgtcctgatgaagacgaa
aaaaccacgttgttaaactggattcgtgaacaacgtaaagcctttttaccagcaaatact
gagggcaccgacaacaatcgcttagttcaaccgattccagatgaaatcatgaccgacgcg
gcgaaagttgccttaggacataaactctttatggatggacgtttatctggcgatggtaca
atccaatgtcacacctgccaccagctaagcaaaggcggtgttgaccgtttagatgtctct
accggcattgatggtaaaaaaggcggtattaacgcaccaaccgtatttaatgctgcgttt
aacttcgttcaattctgggacggacgtgccgtcgatttagccgaccaagccggcggcccg
ccactaaatccagtagaaatgggttcccaatcttgggaggaaattgtggcaaaattcgaa
caagatgaagccttcaaacaggaatttttacaagtctatccgcaaattagcaaagaaact
attactaatgccatcggtgaatatgaaaaaaccttaatcacaccgaatagcgatttcgac
cgctacttaaaaggcgataaaacggcattaaacgcgcaacaattaaaagggtatgaattg
tttaaacagcataaatgcgatacctgccacacgggcgtgaatatgggcggtcaatcttac
gaatacatgggtatttacggtgattacttcaaagatcgtggtacaccaatcacggaagcc
gaccaaggtcgtttcgctcaaacccaagatccttacgatatgcatcgctttaaagtgccg
tcattgcgtaatatcgcattaactgcgccttatatgcacgatgcctccgcaaaagacttg
aaagaagcggttcgtattatgttgaaatatcaaagcaacgctaaaccgcaacaacaagac
attgatgatattacatccttcttagaaagtctgaatggtgaatttgaaggtaagaaattg
caataa

DBGET integrated database retrieval system